KEGG   Rattus norvegicus (rat): 691015Help
Entry
691015            CDS       T01003                                 

Definition
similar to NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2
Orthology
K03946  
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 2
Organism
rno  Rattus norvegicus (rat)
Pathway
Oxidative phosphorylation
Metabolic pathways
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:rno00190]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:rno05010]
Human Diseases; Neurodegenerative diseases; Parkinson's disease [PATH:rno05012]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:rno05016]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:rno04932]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
1q34
AA seq 99 aa AA seqDB search
MAAAAASPVVGAKPALHEIHIHLCQRSPGSQGGRDFIQQWYVELKKVHPDLPILIRECSE
VQSKLWAHYAFGQEKNVSLNNLSAAEVTRAMENVLSSKA
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagctgctgcaagcccagtagtcggtgcaaagccagcattgcatgagattcac
attcacttatgccagcgttccccaggcagccagggtgggagggatttcatccagcaatgg
tacgtggagctgaagaaggtacaccccgacctgcccattctaatccgcgaatgttcagag
gtgcaatccaagctctgggcccactatgcttttggccaagagaagaacgtgtctctgaac
aatctgagtgctgctgaggtgaccagagccatggagaatgtgctaagcagcaaagcttga

DBGET integrated database retrieval system