KEGG   Rattus norvegicus (rat): 691015Help
Entry
691015            CDS       T01003                                 

Definition
similar to NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2
Orthology
K03946  
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 2
Organism
rno  Rattus norvegicus (rat)
Pathway
Oxidative phosphorylation
Metabolic pathways
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    691015
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    691015
   05012 Parkinson's disease
    691015
   05016 Huntington's disease
    691015
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    691015
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q34
AA seq 99 aa AA seqDB search
MAAAAASPVVGAKPALHEIHIHLCQRSPGSQGGRDFIQQWYVELKKVHPDLPILIRECSE
VQSKLWAHYAFGQEKNVSLNNLSAAEVTRAMENVLSSKA
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagctgctgcaagcccagtagtcggtgcaaagccagcattgcatgagattcac
attcacttatgccagcgttccccaggcagccagggtgggagggatttcatccagcaatgg
tacgtggagctgaagaaggtacaccccgacctgcccattctaatccgcgaatgttcagag
gtgcaatccaagctctgggcccactatgcttttggccaagagaagaacgtgtctctgaac
aatctgagtgctgctgaggtgaccagagccatggagaatgtgctaagcagcaaagcttga

DBGET integrated database retrieval system