KEGG   Rattus norvegicus (rat): 78957Help
Entry
78957             CDS       T01003                                 

Gene name
Shank1, Shank1a, Spank1, Sstrip
Definition
SH3 and multiple ankyrin repeat domains 1
Orthology
K15009  
SH3 and multiple ankyrin repeat domains protein
Organism
rno  Rattus norvegicus (rat)
Pathway
Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    78957 (Shank1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q22
AA seq 2167 aa AA seqDB search
MTHSPATSEDEERHSASECPEGGSESDSSPDGPGRGPQGTRGRGSGAPGNLASTRGLQGR
SMSVPDDAHFSMMVFRIGIPDLHQTKCLRFNPDATIWTAKQQVLCALSESLQDVLNYGLF
QPATSGRDANFLEEERLLREYPQSFEKGVPYLEFRYKTRVYKQTNLDEKQLAKLHTKTGL
KKFLEYVQLGTSDKVARLLDKGLDPNYHDSDSGETPLTLAAQTEGSVEVIRTLCLGGAHI
DFRARDGMTALHKAACARHCLALTALLDLGGSPNYKDRRGLTPLFHTAMVGGDPRCCELL
LYNRAQLGIADENGWQEIHQACQRGHSQHLEHLLFYGAEPGAQNASGNTALHICALYNKE
TCARILLYRGANKDVKNNNGQTPFQVAVIAGNFELGELIRNHREQDVVPFQESPKYAARR
RGPPGAGLTVPPALLRANSDTSMALPDWMVFSAPGASSSGTPGPTSGPQGQSQPSAPSTK
LSSGTLRSASSPRGARARSPSRGRHPEDAKRQPRGRPSSSGTPRDGPAGGTGGSGGPGGS
LGSRGRRRKLYSAVPGRSFMAVKSYQAQGEGEISLSKGEKIKVLSIGEGGFWEGQVKGRV
GWFPSDCLEEVANRSQEGRQESRSDKAKRLFRHYTVGSYDSFDAPSLIDGIDSGSDYIIK
EKTVLLQKKDSEGFGFVLRGAKAQTPIEEFTPTPAFPALQYLESVDEGGVAWRAGLRMGD
FLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTRHPDMDEAVHKKASQQAKRLPPP
AISLRSKSMTSELEEMVSPWKKKIEYEQQPAAVPSMEKKRTVYQMALNKLDEILAAAQQT
ISASESPGPGGLASLGKHRPKGFFATESSFDPHHRSQPSYDRPSFLPPGPGLMLRQKSIG
AAEDDRPYLAPPAMKFSRSLSVPGSEDIPPPPTTSPPEPPYSTPPAPSSSGRLTPSPRGG
PFNPSSGGPLPASSPSSFDGPSPPDTRGGGREKSLYHSAALPPAHHHPPHHHHHHAPPPQ
PHHHHAHPPHPPEMETGGSPDDPPPRLALGPQPSLRGWRGGGPSPTSGAPSPSHHSSSGG
SSGPTQAPALRYFQLPPRAASAAMYVPARSGRGRKGPLVKQTKVEGEPQKGSIPSASSPT
SPALPRSEPPPAGPSEKNSIPIPTIIIKAPSTSSSGRSSQGSSTEAEPPTQPDGAGGGGS
SPSPAPATSPVPPSPSPVPTPASPSGPATLDFTSQFGAALVGAARREGGWQNEARRRSTL
FLSTDAGDEDGGDSGLGPGGPPGPRLRHSKSIDEGMFSAEPYLRLESGGSSGGYGAYAAG
SRAYGGSGSSSAFTSFLPPRPLVHPLTGKALDPASPLGLALAARERALKESSEGGGTPQP
PPRPPSPRYDAPPPTLHHHSPHSPHSPHARHEPVLRLWGDPARRELGYRAGLGSQEKALT
ASPPAARRSLLHRLPPTAPGVGPLLLQLGPEPPTPHPGVSKAWRTAAPEEPERLPLHVRF
LENCQARPPPAGTRGSSTEDGPGVPPPSPRRVLPTSPTSPRGNEENGLPLLVLPPPAPSV
DVDDGEFLFAEPLPPPLEFSNSFEKPESPLTPGPPHPLPDPPSPATPLPAAPPPAVAAAP
PTLDSTASSLTSYDSEVATLTQGAPAAPGDPPAPGPPAPAAPAPPAPQPGPDPPPGTDSG
IEEVDSRSSSDHPLETISSASTLSSLSAEGGGNTGGVAGGGAGVASGTELLDTYVAYLDG
QAFGGSGTPGPPYPPQLMTPSKLRGRALGTSGNLRPGPSGGLRDPVTPTSPTVSVTGAGT
DGLLALSACPGPSTAGVAGGPVAVEPEVPPVPLPAASSLPRKLLPWEEGPGPPPPPLPGP
LSQPQASALATVKASIISELSSKLQQFGGSSTAGGALPWARGGSGGSTDSHHGGASYIPE
RTSSLQRQRLSEDSQTSLLSKPSSSIFQNWPKPPLPPLPTGSGVSSSTAAAPGATSPSAS
SASASTRHLQGVEFEMRPPLLRRAPSPSLLPASDHKVSPAPRPSSLPILPSGPIYPGLFD
IRSSPTGGAGGSTDPFAPVFVPPHPGISGGLGGALSGASRSLSPTRLLSLPPDKPFGAKP
LGFWTKFDVADWLEWLGLSEHRAQFLDHEIDGSHLPALTKEDYVDLGVTRVGHRMNIDRA
LKFFLER
NT seq 6504 nt NT seq  +upstreamnt  +downstreamnt
atgacccacagccccgcgacaagcgaggacgaggaacgccacagtgccagcgagtgtccc
gaggggggctcagaatcggacagctccccagacggaccaggaagaggcccccagggtact
cggggccggggcagcggagcacctggtaacctggcctctacccgaggcctccagggacgc
tccatgtctgtccctgacgacgcccacttcagcatgatggttttcaggattggcatccct
gacttgcaccagacgaaatgcctacgcttcaacccggatgctaccatctggacagccaaa
cagcaagtactctgtgccctgagcgagagtctacaggatgtgctaaactatggactgttc
cagccagccacctcaggccgggatgccaacttcctggaggaagagaggcttctaagagag
taccctcagtcctttgagaaaggggtaccctacctggagttccgctacaagacccgagtc
tacaaacagaccaacctggatgagaaacagctggccaaactgcacacgaagacggggttg
aagaagttccttgaatatgtgcagctcgggacgtctgacaaggtggcgaggctgctggac
aaggggctggaccccaattaccacgactcagattcaggagagacacctttgaccctggcg
gcccagactgaaggctcagtagaggtgattcggacgctgtgcctgggcggggcgcacata
gacttcagggcccgggatggcatgacagcgctgcacaaagctgcatgtgctaggcactgc
ctggcactcacggcacttctggaccttgggggctcccccaactacaaggatcgacgaggg
ctgacccccctgttccacacagctatggttgggggagacccccgctgttgtgagctactt
ctgtacaacagggcccagctgggcattgcagatgagaacggctggcaggaaatccaccag
gcctgccaacgagggcactctcagcacctggaacacctgctcttctatggggctgagcct
ggagcccagaatgcctcaggaaacacggccctgcacatctgtgctctctacaacaaggag
acctgtgccaggatcctcctttatcgcggagcaaacaaggatgtgaaaaataacaacgga
cagacacccttccaggtggctgtgattgctgggaattttgagctgggggaactgattcgt
aaccatcgggaacaggatgtggtacccttccaggagtcccccaagtatgcagcccggcgt
cggggacccccaggcgcagggctgactgtacccccagcgctgctgcgggctaacagcgac
acgagcatggcgctgcctgattggatggtgttttcggccccaggggcctcatcctctggg
acccctggccctacctcaggaccccagggccagtcacagccctcggcccccagcaccaag
ctcagtagtgggaccctcagaagtgccagcagcccccgaggtgcccgggcacgctcccca
tcccgggggagacatcctgaagatgccaagagacaacctcgaggccgacccagctccagc
gggacaccccgagatgggccggctgggggaactgggggctcagggggccctgggggctcc
ctgggtagcagaggcagacgtaggaagctctattcagcggtacctggacgctccttcatg
gcggtgaagtcataccaggcgcaaggcgagggggagatctctctgagtaaaggcgaaaag
atcaaagtgctcagcatcggggaaggaggcttctgggaaggccaggtcaaaggtcgagtt
ggctggttcccttctgactgcctagaagaggtggcaaaccgttcccaggagggaagacaa
gaaagccgaagtgacaaggcaaagagactcttcaggcattacacagtgggctcttacgac
agcttcgatgccccaagtctgatcgatgggattgactcagggagtgattacatcatcaag
gagaagacagtcttactgcagaagaaggacagtgaggggttcgggttcgtgctccggggg
gccaaggcgcagacccccatcgaggaattcacccccaccccggccttcccggcgctgcag
tacctcgagtctgtggacgagggtggcgtggcatggcgggctggactacggatgggagac
ttcctcatcgaggtgaatggacagaatgtagtgaaggttggccaccgccaggtggtcaac
atgatccgacagggaggcaacacactgatggtcaaggtggtgatggtgaccagacaccca
gacatggacgaggctgtccacaagaaagcatcccagcaggctaagcggctcccgccccca
gccatctccctgcgttccaagtctatgacctcagagctggaggaaatggtctccccctgg
aagaagaaaattgaatacgagcaacagcccgcggcagtgcccagcatggagaaaaagagg
actgtgtatcagatggcactcaacaaactggatgagatcttggccgctgctcagcagacc
atcagcgcaagtgagagtcctgggcctggtggcctggcatccctgggcaagcaccgaccc
aaaggattctttgccactgagtcgagctttgatcctcaccaccgctcccagccaagttat
gaccggccttctttcctgcctcctggacccggccttatgctccggcagaaatctatcggg
gctgcggaagacgacagaccctacctagcacccccagccatgaaattcagtcgtagcctg
tcagtccccggttcagaggacatacccccaccacccactacatcaccaccagagccgccc
tatagcacacctccggccccctcctcctccggccgcctcactccctcgcctcggggaggg
ccctttaaccccagttctgggggtccccttcccgcctcctccccttcatctttcgatggg
ccatctcctcctgacacccgtggtgggggccgagaaaagagcctatatcacagcgcagcc
ctgccccctgcccaccaccatccacctcatcaccaccatcatcacgcgccacctccccag
ccccaccatcaccatgcacatcctcctcacccaccggagatggagacaggaggttccccc
gacgatcccccacctcgattggccctgggaccccagcccagccttcgaggctggcgaggt
ggaggacccagcccgacctcgggggccccatcaccttcccaccacagtagcagcggaggc
agcagcggccctactcaggctcccgccctgcgctacttccaactgcccccgagggcggcc
agtgcggctatgtatgtaccagcacgttccggccgcggtcgcaagggcccactggtcaag
cagaccaaagtggaaggcgagccccaaaagggcagcatcccttccgcgtcctctccaaca
tccccggcgttgcctcggtctgaaccacctccggccgggccgtcggagaaaaattccatc
cctatcccgaccatcatcatcaaagccccatctaccagtagcagcggccgcagcagtcag
ggaagcagcacagaggctgagccccccacccagcccgatggcgcgggcggcggcggatcc
tcgcctagccctgcacctgccacgtcccctgtgccgccatccccgtcgcccgtgcccact
cccgcgtcacccagcggcccggccaccctggatttcactagccagtttggagcagcccta
gtaggcgcggcgcggagggagggaggctggcagaacgaagcccggcggcggtccacgctg
ttcctgtccaccgacgcaggagatgaggatggaggcgacagcgggctgggcccggggggg
cccccgggtccccggctgcgccattccaaatccattgacgaaggcatgttctccgcagag
ccgtacctccggctggagtcggggggcagcagtgggggctacggggcctacgcagcgggc
agccgagcctacgggggcagcgggagcagcagcgccttcaccagcttcctccccccgcgg
cccctggtgcatccgctgaccggcaaagccttggatcccgcctctccgctggggttggcc
ttggccgcccgggagcgggccttgaaggagtcctcggagggtgggggcacccctcagccg
cccccgagacctccatcaccacgctacgacgccccaccgcctacccttcaccaccactcg
ccccattcaccccattcgccacatgcgcgtcacgagccagtgttgcgcctctggggggac
cccgcgcgccgggagctggggtaccgggcaggcctagggagtcaggagaaggcccttacc
gccagtccacctgcagctcgccgctccctactgcaccgtctgcccccgacggctcccggg
gtcgggccgctcctgctgcagctggggccggagcccccaactccccatcctggggtgagc
aaggcctggcgcacagcagccccggaggagccggagcggctgccgctgcacgtgcgattc
cttgagaattgccaagcccggcctcccccagctggcacgagagggtcctctactgaagat
gggcctggggtcccgcctcccagccctcgcagagtcttgccaacctctcccacctcccca
cgaggcaacgaggagaacggccttccgctactggtcctgccaccgccagccccttcggtg
gatgtggacgacggcgagttcttgtttgcggagccgctgcctccacccctggagttttcc
aatagtttcgaaaagccagagtcgcctctcacacccgggcctcctcacccactccctgac
cctccctccccggctacccctctacccgcagccccacctcccgctgtagccgcagcccct
cccaccttggactccacagcatccagcctgacctcttacgacagcgaagtggccacactg
acccagggggctcccgcggctcctggggatcctccagctccaggcccgccggccccggca
gccccagctcccccagcaccgcagccaggccctgatcctccacctggcacagattctgga
attgaggaggtggacagtcggagtagcagtgatcacccgctggagaccatcagcagcgca
tccacactcagcagcttgtccgccgaaggaggaggcaatacagggggcgtggctgggggc
ggggccggggtggccagtgggacggagctcctggacacctacgttgcctacctggatggc
caggccttcgggggcagtggaactcctggcccaccatatcctccccagctcatgactcct
tctaagctccggggcagggcgcttgggactagtggaaatttaagacctggtcccagtggg
ggactccgagatcctgtcacccccaccagccccactgtctctgtgaccggagctggaaca
gatgggctactggccttgagtgcttgccctggaccctcaacggcaggtgtggcagggggt
cccgtggcagttgagccagaagtcccgcctgtacctttgcccgctgcctcatccctgcct
cggaagctattaccgtgggaggagggtccgggaccaccaccaccacccctgccagggccc
ctgtcccagcctcaggcctctgccttggccacggtcaaagccagcatcatcagcgaactc
agctccaagctccagcagtttggtgggtcctctaccgcaggaggagctctgccttgggct
cggggaggcagcgggggcagcacagacagccaccacggaggagccagttacatcccagag
aggacgtcctccctgcagcggcagaggctctctgaagactcccagacctctctcctctcc
aaacccagcagcagcatctttcagaactggcctaaaccccctctgccaccactccccact
gggtctggggtctcctcttcaacagctgcagccccgggagctacatccccttcagcctca
tctgcctcagcttccaccagacacctgcaaggtgtggaatttgagatgcggcctccgctg
ctccgccgggcacccagcccttcgttgctgcctgcttcggatcacaaggtcagcccagcg
cccaggccttcctctttgcccatcctgccttcaggacccatctacccgggcctcttcgac
atccgtagctctccaaccggaggggcgggaggctcgactgaccccttcgctcccgtcttt
gtgccaccacaccccgggatatctgggggtcttggaggagccttgtctggggcctctcgc
tccctatcacccacccgcctgctctcgctgcccccggacaagccgttcggcgccaagcct
ctagggttctggaccaagtttgacgtcgccgattggctagagtggctgggcttgtcggag
caccgagcccagttcctggaccacgagattgatggctcccatctgcctgccttgaccaag
gaggactatgtggacctgggtgtaaccagggtgggccaccgtatgaacattgaccgggct
ctcaaatttttcctggagaggtga

DBGET integrated database retrieval system