KEGG   Rattus norvegicus (rat): 79116Help
Entry
79116             CDS       T01003                                 

Gene name
Apex1, APE, Apex, REF-1
Definition
(RefSeq) apurinic/apyrimidinic endodeoxyribonuclease 1 (EC:4.2.99.18)
  KO
K10771  
AP endonuclease 1 [EC:4.2.99.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
Base excision repair
Module
BER complex
Brite
KEGG Orthology (KO) [BR:rno00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    79116 (Apex1)
Enzymes [BR:rno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     79116 (Apex1)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     79116 (Apex1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
15p14
AA seq 317 aa AA seqDB search
MPKRGKRAAAEDGEEPKSEPETKKSKGAAKKTEKEAAGEGPVLYEDPPDQKTSASGKSAT
LKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLTHQYWSA
PSDKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFESFILVTAYVPNAGRGLVR
LEYRQRWDEAFRKFLKDLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFG
EMLQAVPLADSFRHLYPNTAYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIR
SKALGSDHCPITLYLAL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgccgaagcgggggaagagagcggcagcggaagacggggaagaacccaagtccgagcca
gagaccaagaagagtaagggggcagcaaagaaaactgagaaggaggccgcaggagagggc
cctgtcctgtatgaggaccctccagatcagaaaacgtcagccagtggcaaatctgccaca
ctcaagatatgctcctggaatgtggatgggcttcgagcctggattaaaaagaaaggcttg
gattgggtaaaggaagaagcaccagacatcttgtgcctccaagagaccaaatgctcagag
aacaaactcccggctgaactgcaagagctgcctggactcacccatcagtactggtcagct
ccatcagacaaagaaggatatagtggtgtgggcctactttcccgccaatgcccgctcaaa
gtctcttatggcattggtgaggaagaacatgatcaagaaggccgggtgattgtggctgaa
tttgagtcctttatcttggtaacagcctatgttccgaacgcaggaaggggtctggtaaga
ctggagtaccgacagcgatgggatgaagccttcagaaagtttctaaaggacttggcttcc
cggaaacctcttgtgctgtgtggggatctcaatgtggctcatgaagaaatagaccttcgt
aaccccaaaggaaacaaaaagaatgctggttttactccccaggagcgccaaggctttggg
gaaatgctacaggctgtaccactggctgacagcttccggcatctctaccccaacactgcc
tacgcttatactttctggacttacatgatgaatgcccgctctaagaatgttggttggcgc
cttgattactttttgctgtctcactctcttttacctgctttgtgcgacagcaagatccgg
tccaaggctcttggcagtgaccactgtcccatcaccctttacctagcactgtga

DBGET integrated database retrieval system