KEGG   Rattus norvegicus (rat): 79223Help
Entry
79223             CDS       T01003                                 

Gene name
Gk, ASTP, Gyk
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glycerolipid metabolism
Metabolic pathways
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    79223 (Gk)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    79223 (Gk)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     79223 (Gk)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   79223 (Gk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
Xq22
AA seq 524 aa AA seqDB search
MAAAKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEI
LQSVYECIEKTCEKLGQLNIDISNIKAIGVSNQRETTVVWDKLTGEPLYNAVVWLDLRTQ
STVEKLSKRIPGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVKKVQEAVEENRALFGTIDS
WLIWSLTGGINGGVHCTDVTNASRTMLFNIHSLEWDKELCEFFGIPMEILPNVRSSSEIY
GLMKAGALEGVPISGCLGDQSAALVGQMCFQDGQAKNTYGTGCFLLCNTGHKCVFSEHGL
LTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIKSSEEIEKLAKEVGTSYGCYF
VPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLS
HLQVDGGMTSNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLS
AVTMERFEPQINAEESEIRYSTWKKAVMKSIGWVTTQSPESGIP
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggcagccgcgaagaaagcagttctggggccattggtgggagcagtggaccagggtacc
agctcgacacgttttttggttttcaattcaaaaacagctgaacttcttagtcatcatcaa
gtagaaataaaacaggaattcccaagagaaggatgggtagaacaagatccgaaggaaatc
ctgcagtctgtttatgaatgtatagagaaaacatgtgagaaacttggacagctcaatatt
gatatttccaacatcaaagctattggtgtcagcaaccagagggaaaccacagtagtctgg
gacaagctaactggagagccgctctacaatgctgtggtgtggcttgacctaagaacccaa
tctactgttgagaaacttagtaaaagaattccgggaaataataattttgtcaagtccaag
acaggccttccacttagcacttacttcagtgcagtgaaacttcgttggctcctcgacaat
gtgaaaaaggtccaagaggctgtcgaagaaaatagagctctttttgggaccattgattca
tggcttatttggagtttgacagggggaatcaatggcggtgttcactgtacagatgtaaca
aatgcaagcaggacgatgctttttaacattcattctttggaatgggataaagagctctgc
gaattttttggaattccaatggaaattcttcccaatgttcggagttcttctgagatctat
ggcctaatgaaagctggggccttggaaggtgtgccaatatctgggtgtttgggggaccag
tctgctgctttggtgggacaaatgtgcttccaggatggacaggccaaaaacacgtatgga
acagggtgcttcttactgtgtaacacgggccataagtgtgtattttctgaacatggcctt
ttgacaactgtggcttataaacttggcagagacaaacctgtgtattatgcattagaaggt
tctgtagctatagctggtgctgtaatccgctggttaagagacaaccttggaattattaag
tcctctgaagaaattgaaaaacttgctaaagaagtaggtacttcttatggctgctacttt
gttccagcattttcagggttatatgcaccttattgggagcctagtgcaagagggatcatc
tgtggactcactcagttcaccaataaatgtcatatcgcttttgctgcattagaagctgtt
tgttttcaaacccgagagattttggatgccatgaaccgtgactgtggaatcccactcagc
catttgcaggtagatggaggaatgaccagcaataaaattcttatgcagctacaagcagac
attctgtatattccagtagtgaagccctccatgcccgagacaactgctctaggagctgcc
atggcagctggggctgcagagggggttggtgtctggagtcttgaacctgaggatttgtca
gctgtcacaatggagcggttcgaacctcagatcaatgctgaagaaagtgaaatccgttac
tccacctggaagaaagctgtgatgaagtccattggttgggttacaactcaatctcctgaa
agtggtatcccataa

DBGET integrated database retrieval system