KEGG   Rattus norvegicus (rat): 79246Help
Entry
79246             CDS       T01003                                 

Gene name
Htr3a, 5-HT3, 5-HT3A, 5HT3, Htr3
Definition
(RefSeq) 5-hydroxytryptamine receptor 3A
  KO
K04819  
5-hydroxytryptamine receptor 3
Organism
rno  Rattus norvegicus (rat)
Pathway
Serotonergic synapse
Taste transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    79246 (Htr3a)
  Sensory system
   04742 Taste transduction
    79246 (Htr3a)
Ion channels [BR:rno04040]
 Cys-loop superfamily
  Serotonin (5-HT3)
   79246 (Htr3a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
8q23
AA seq 483 aa AA seqDB search
MPLCIPQVLLALFLSVLIAQGEGSRRRATQAHSTTQPALLRLSDHLLANYKKGVRPVRDW
RKPTLVSIDVIMYAILNVDEKNQVLTTYIWYRQFWTDEFLQWTPEDFDNVTKLSIPTDSI
WVPDILINEFVDVGKSPSIPYVYVHHQGEVQNYKPLQLVTACSLDIYNFPFDVQNCSLTF
TSWLHTIQDINISLWRTPEEVRSDKSIFINQGEWELLGVFTKFQEFSIETSNSYAEMKFY
VVIRRRPLFYAVSLLLPSIFLMVVDIVGFCLPPDSGERVSFKITLLLGYSVFLIIVSDTL
PATAIGTPLIGVYFVVCMALLVISLAETIFIVQLVHKQDLQRPVPDWLRHLVLDRIAWLL
CLGEQPMAHRPPATFQANKTDDCSAMGNHCSHVGSPQDLEKTSRSRDSPLPPPREASLAV
RGLLQELSSIRHSLEKRDEMREVARDWLRVGYVLDRLLFRIYLLAVLAYSITLVTLWSIW
HYS
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgccgctctgcatcccgcaggtgctgttggccttgttcctttccgtgctgatagcccag
ggagaaggcagccggaggagggccacccaggcccacagcaccacccagcctgctctgctg
aggctgtcagatcacctcctggctaactacaagaagggagtgcggcctgtgcgggactgg
aggaagcccaccctggtctccattgatgtcatcatgtatgccatcctcaacgtggatgag
aagaaccaggttctgaccacctacatatggtaccggcagttctggaccgacgagtttcta
cagtggactcctgaggacttcgacaatgtcaccaaattgtccatccccaccgacagcatc
tgggtccctgacatcctcatcaatgagtttgtggacgtggggaagtctccaagcattcct
tatgtgtatgtgcaccatcaaggtgaagtccagaactacaagcccctacagctggtgacc
gcctgtagccttgacatctataacttcccgttcgatgtgcagaactgctctctgaccttc
accagctggctgcataccatccaggacatcaacatttccctgtggcgaacaccagaagaa
gtgaggtcggacaagagcatcttcataaatcagggcgagtgggagctgctgggggtgttc
accaaatttcaggagttcagtatagaaaccagtaacagctatgcggaaatgaagttctac
gtggtcatccgccggcggcctttattctacgcagtcagcctcttgctgcccagtatcttc
ctcatggtcgtggacattgtgggcttttgtctgcccccggacagtggtgagagagtgtct
ttcaagatcacgctccttctgggatactcagtctttctcatcatcgtgtcagacacactg
cctgcaacggccatcggcactcccctcattggtgtctactttgtagtgtgcatggctctg
ctggtgataagcctcgctgagaccatcttcattgtgcagctggtgcataagcaggattta
cagcgccctgtacctgactggctgaggcacctggtcctagacagaatagcctggctgctc
tgcctaggggagcagcccatggcccataggcccccagccaccttccaagccaacaagact
gatgactgctcagccatgggaaaccactgcagccatgtcggaagccctcaggacttggag
aagacctcgaggagcagagatagccctcttccaccaccaagggaggcctcgctggctgtg
cgtggcctcttgcaagagctgtcctccatccgccactccctggagaagcgggatgagatg
cgggaggtggcaagggactggttgcgggtgggatatgtgctggacaggctgctgtttcgc
atctacctgctggccgtgctggcttacagcatcaccctggtcacgctctggtccatttgg
cattattcctga

DBGET integrated database retrieval system