KEGG   Rattus norvegicus (rat): 79250Help
Entry
79250             CDS       T01003                                 

Gene name
Aco2
Definition
aconitase 2, mitochondrial (EC:4.2.1.3)
Orthology
K01681  
aconitate hydratase [EC:4.2.1.3]
Organism
rno  Rattus norvegicus (rat)
Pathway
Citrate cycle (TCA cycle)
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Class
Metabolism; Overview; Carbon metabolism [PATH:rno01200]
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:rno01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:rno01230]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:rno00020]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:rno00630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
7q34
AA seq 780 aa AA seqDB search
MAPYSLLVTRLQKALGVRQYHVASALCQRAKVAMSHFEPSEYIRYDLLEKNINIVRKRLN
RPLTLSEKIVYGHLDDPANQEIERGKTYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAV
PSTIHCDHLIEAQLGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWRPGSGIIHQIILEN
YAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGTLSG
WTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYN
HRMKKYLSKTGRADIANLAEEFKDHLVPDPGCQYDQVIEINLNELKPHINGPFTPDLAHP
VADVGTVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGLKCKSQFTITPGS
EQIRATIERDGYAQILRDVGGIVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRN
DANPETHAFVTSPEIVTALAIAGTLKFNPETDFLTGKDGKKFKLEAPDADELPRSDFDPG
QDTYQHPPKDSSGQRVDVSPTSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDHISAA
GPWLKFRGHLDNISNNLLIGAINIENGKANSVRNAVTQEFGPVPDTARYYKKHGIRWVVI
GDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPSDYNKIHP
VDKLTIQGLKDFAPGKPLNCIIKHPNGTQETILLNHTFNETQIEWFRAGSALNRMKELQQ
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atggcgccttacagcctactggtcacccggctgcagaaggccctgggtgtgcggcagtac
catgtggcctctgccctgtgccaacgggccaaggtggccatgagccactttgagcccagt
gagtacatccgatatgacctgctagagaagaacattaacattgtccgtaaacggttgaac
cggcctcttactctctcggagaagattgtgtatggacacctggatgacccagccaaccag
gagatcgagcggggaaagacatacctgcgtttacggcccgaccgggtggccatgcaggat
gcaacagcccagatggctatgctacagtttattagcagtgggctgcccaaggtggctgtg
ccatcaaccatccactgtgatcatctgattgaggcccagcttgggggtgagaaagaccta
cgccgggccaaggacataaaccaggaagtatataatttcctggcaactgccggtgccaag
tatggtgtgggcttctggaggcctggatctggaatcattcaccagatcattctagaaaac
tatgcataccctggagttcttctgattggcactgactcccacacccccaatgggggtggc
ctgggaggtatctgcattggagtagggggtgctgatgctgtggatgtcatggctgggatc
ccctgggagctgaagtgtcccaaggtgattggcgtgaagctgacgggcaccctctctggt
tggacctcacccaaagatgtgatcctgaaagtggccggcatcctcacagtgaaaggtggc
acaggtgccattgtggaataccatggacctggtgtcgactccatctcctgcactggcatg
gcaacaatttgcaacatgggtgcagaaattggggccactacatcagtgttcccctacaac
cacaggatgaaaaagtacctgagcaagacaggccgagcagacattgccaacctagcagaa
gaattcaaggatcacttagtgcctgaccctggctgccagtatgaccaagtgattgaaatt
aacctcaatgagctaaagccacatatcaatggaccctttacccctgacttggctcaccca
gtggcagatgtgggcactgtggcagagaaggaagggtggcctctggacatcagagtaggt
ttgattggcagctgcaccaattcaagctacgaggacatgggacgatcagcagctgtggcc
aagcaagccctggcgcacggactcaagtgcaagtctcagttcaccatcaccccaggctct
gagcagatccgagccactatcgagcgggatggctatgcacagatcctaagggatgtgggt
ggaatcgttttggccaatgcctgtggcccttgcatcggccagtgggacaggaaagacatc
aagaagggggagaagaatacaatcgtcacctcctacaacaggaacttcacaggccgtaat
gatgcaaatcctgagacccatgcctttgtcacatccccagagattgtcacagccctggcc
attgcgggaacccttaagttcaacccagaaactgacttcttaacaggcaaggatggcaag
aagttcaagttggaggctccagatgcagatgagcttccccgatcggactttgatccaggg
caggacacataccagcacccccctaaggacagcagtggccagcgggtggatgtgagccct
accagccagcgcctgcagctcctggaaccttttgacaaatgggatggcaaagacctagag
gacctgcaaatccttatcaaggtcaaagggaagtgcaccacagaccacatttctgctgcc
ggcccctggctcaagttccgtgggcatctggataacatctctaataacctgcttatcggt
gccatcaacatcgaaaatggcaaagccaattctgtgcgcaatgctgtcacccaggagttt
ggccctgtacctgacactgctcgctactacaagaaacatggcatcaggtgggtggtgatt
ggagatgagaactacggtgaaggctcaagccgggagcacgcagcactggagcctcgccat
ctggggggccgagccatcatcaccaagagcttcgcaaggatccatgaaaccaatctaaag
aagcagggcttgctgcccctcacctttgctgacccctctgactacaacaagattcatcca
gtggacaagctgaccattcaaggcctgaaggactttgcccctggcaagcctctgaactgc
atcatcaagcaccccaatgggacccaggagaccatcctgctgaaccacactttcaacgag
acacagatcgagtggttccgtgcaggcagcgccctcaacaggatgaaggagctgcagcag
tga

DBGET integrated database retrieval system