KEGG   Rattus norvegicus (rat): 81530Help
Entry
81530             CDS       T01003                                 

Gene name
Pdk2
Definition
pyruvate dehydrogenase kinase, isozyme 2 (EC:2.7.11.2)
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     81530 (Pdk2)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [Table]
   81530 (Pdk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q31
AA seq 407 aa AA seqDB search
MRWFRALLKNASLAGAPKYIEHFSKFSPSPLSMKQFLDFGSSNACEKTSFTFLRQELPVR
LANIMKEINLLPDRVLSTPSVQLVQSWYVQSLLDIMEFLDKDPEDHRTLSQFTDALVTIR
NRHNDVVPTMAQGVLEYKDTYGDDPVSNQNIQYFLDRFYLSRISIRMLINQHTLIFDGST
NPAHPKHIGSIDPNCSVSDVVKDAYDMAKLLCDKYYMASPDLEIQEVNATNATQPIHMVY
VPSHLYHMLFELFKNAMRATVESHESSLTLPPIKIMVALGEEDLSIKMSDRGGGVPLRKI
ERLFSYMYSTAPTPQPGTGGTPLAGFGYGLPISRLYAKYFQGDLQLFSMEGFGTDAVIYL
KALSTDSVERLPVYNKSAWRHYQTIQEAGDWCVPSTEPKNTSTYRVS
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgcgctggttccgggcgctgttgaagaatgcgtccctggcaggggcgcccaagtacatc
gagcacttcagcaagttctccccgtccccgctgtccatgaagcagtttctagacttcgga
tccagcaatgcctgcgagaaaacttcattcaccttcctccggcaggagctgcccgtgcgc
ctggccaacatcatgaaagagatcaacctgcttcctgaccgggtgctgagcaccccctca
gtgcaactggtgcagagctggtatgtccagagtctgctggacatcatggaattcctggac
aaggaccccgaggaccaccggaccctaagccagttcactgatgccctggtcaccatccgg
aaccggcacaatgacgtagtgcccaccatggcacagggagtgttggagtacaaggacacc
tatggtgatgacccagtctccaaccagaacatccagtactttttggaccgcttctacctc
agccgcatctctatccgcatgctcattaaccagcacaccctcatctttgatggcagcacc
aacccagcccaccccaaacacattggcagcattgatcccaactgcagcgtgtctgatgtg
gtgaaagatgcctatgacatggctaagctcctgtgtgacaagtattacatggcttcccct
gacctggagatccaggaagtcaatgccaccaacgccacccagcccattcacatggtctac
gtcccctcccacctctaccacatgctctttgaactcttcaagaatgccatgcgggccaca
gtggaaagccacgagtccagcctcactctccctcccatcaaaatcatggtggccctcggt
gaagaagatctgtccatcaaaatgagtgaccgaggcgggggtgtccccttgaggaagatc
gagaggctcttcagctacatgtactctacagctcctacaccccagcctggcactgggggt
accccgctggctggctttgggtatggactccccatttcccgcctctacgccaagtacttc
cagggggacttgcagctcttctctatggagggctttgggacagatgctgtcatctatctg
aaggccctgtccacggactcagtggagcgcctgcctgtctacaacaagtctgcctggcgc
cactaccagaccatccaggaggccggtgactggtgcgtgcccagcacagagcccaagaac
acatcgacgtatcgggtcagctag

DBGET integrated database retrieval system