KEGG   Rattus norvegicus (rat): 81531Help
Entry
81531             CDS       T01003                                 

Gene name
Pfn2
Definition
profilin 2
Orthology
K05759  
profilin
Organism
rno  Rattus norvegicus (rat)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    81531 (Pfn2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    81531 (Pfn2)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    81531 (Pfn2)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   81531 (Pfn2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
2q31
AA seq 149 aa AA seqDB search
MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPAEIDVIIGKDREGFF
TNGLTLGGKKCSVIRDSLYVDSDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH
GGGLNKKAYSMAKYLRDSWVLAARQTVKY
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc
gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttc
cagagcatcacgccagcagaaatagatgtgattataggaaaagaccgggaaggtttcttt
accaatggtttgactcttggaggaaagaagtgctctgtgatcagagatagcctatacgtt
gactcggactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaac
gttgctgttggcagagctgggagagtcttggtctttgtaatgggaaaagaaggggtccat
ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactcttgggtt
ctagctgctaggcagactgttaagtattag

DBGET integrated database retrieval system