KEGG   Rattus norvegicus (rat): 81633Help
Entry
81633             CDS       T01003                                 

Gene name
Acta2
Definition
actin, alpha 2, smooth muscle, aorta
Orthology
K12313  
actin, aortic smooth muscle
Organism
rno  Rattus norvegicus (rat)
Pathway
Vascular smooth muscle contraction
Class
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:rno04270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
1
AA seq 377 aa AA seqDB search
MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK
MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL
DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEK
SYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNV
LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS
KQEYDEAGPSIVHRKCF
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgaagaggaagacagcacagctctggtgtgtgacaatggctccgggctctgtaag
gcgggctttgctggtgatgatgctcccagggctgttttcccatccatcgtgggacgtccc
agacaccagggagtgatggttggaatgggccaaaaggacagctatgtgggggacgaagcg
cagagcaagagagggatcctgaccctgaagtatccgatagaacacggcatcatcaccaac
tgggacgacatggaaaagatctggcaccactccttctataacgagcttcgcgtggcccca
gaggagcatccgaccttgctaacggaggcgccgctgaaccctaaggccaaccgggagaaa
atgacccagattatgtttgagaccttcaatgtccctgccatgtatgtggctattcaggct
gtgctgtccctctatgcttctggacgtacaactggtattgtgctggactctggagatggc
gtgactcacaacgtgcctatctatgagggctatgctctgcctcatgccatcatgcgtctg
gacttggctggccgagatctcaccgactacctcatgaagatcctgactgagcgtggctat
tccttcgtgactactgctgagcgtgagatcgtccgtgacatcaaggagaagctgtgctat
gtcgctctggactttgaaaatgagatggccactgctgcttcctcttcttccctggagaag
agctacgaactgcctgatgggcaggtgatcaccatcgggaatgaacgcttccgctgcccg
gagaccctcttccagccatctttcattggaatggagtcggcgggcatccacgaaaccacc
tataacagcatcatgaagtgtgatattgacatcaggaaggacctctatgctaacaacgtc
ctctcggggggcactaccatgtacccaggcattgctgacaggatgcagaaggagatcaca
gccctcgctcccagcaccatgaagatcaagattattgctcctccagaacgcaaatattct
gtctggatcggcggctccatcctggcttctctatctaccttccagcagatgtggatcagc
aaacaggagtatgacgaagctggcccctccattgtccaccgcaaatgcttctaa

DBGET integrated database retrieval system