KEGG   Rattus norvegicus (rat): 81646Help
Entry
81646             CDS       T01003                                 

Gene name
Creb1, Creb
Definition
cAMP responsive element binding protein 1
Orthology
K05870  
cyclic AMP-responsive element-binding protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
cGMP-PKG signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Adrenergic signaling in cardiomyocytes
Osteoclast differentiation
Antigen processing and presentation
TNF signaling pathway
Circadian rhythm
Circadian entrainment
Cholinergic synapse
Dopaminergic synapse
Insulin secretion
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Vasopressin-regulated water reabsorption
Huntington's disease
Cocaine addiction
Amphetamine addiction
Alcoholism
Tuberculosis
Hepatitis B
HTLV-I infection
Viral carcinogenesis
Prostate cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    81646 (Creb1)
   04022 cGMP - PKG signaling pathway
    81646 (Creb1)
   04151 PI3K-Akt signaling pathway
    81646 (Creb1)
   04152 AMPK signaling pathway
    81646 (Creb1)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    81646 (Creb1)
  Endocrine system
   04911 Insulin secretion
    81646 (Creb1)
   04915 Estrogen signaling pathway
    81646 (Creb1)
   04918 Thyroid hormone synthesis
    81646 (Creb1)
   04916 Melanogenesis
    81646 (Creb1)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    81646 (Creb1)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    81646 (Creb1)
  Nervous system
   04725 Cholinergic synapse
    81646 (Creb1)
   04728 Dopaminergic synapse
    81646 (Creb1)
  Development
   04380 Osteoclast differentiation
    81646 (Creb1)
  Environmental adaptation
   04710 Circadian rhythm
    81646 (Creb1)
   04713 Circadian entrainment
    81646 (Creb1)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    81646 (Creb1)
   05215 Prostate cancer
    81646 (Creb1)
  Neurodegenerative diseases
   05016 Huntington's disease
    81646 (Creb1)
  Substance dependence
   05030 Cocaine addiction
    81646 (Creb1)
   05031 Amphetamine addiction
    81646 (Creb1)
   05034 Alcoholism
    81646 (Creb1)
  Infectious diseases
   05152 Tuberculosis
    81646 (Creb1)
   05166 HTLV-I infection
    81646 (Creb1)
   05161 Hepatitis B
    81646 (Creb1)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   CREB
    81646 (Creb1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    81646 (Creb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q32
AA seq 341 aa AA seqDB search
MTMDSGADNQQSGDAAVTEAESQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD
SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG
QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV
VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC
RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggactctggagcagacaaccagcagagtggagatgctgctgtaacagaagct
gaaagtcaacaaatgacagttcaagcccagccacagattgccacattagcccaggtatcc
atgccagcagctcatgcgacgtcatctgctcccactgtaaccttagtgcagctgcccaat
gggcagacagtccaggtccatggggtcatccaggcggcccagccatcagttattcagtct
ccacaagtccaaacagttcagtcttcctgtaaggacttaaaaagacttttctccggaact
cagatttcaactattgcagaaagtgaagattcacaggagtctgtggatagtgtaactgat
tcccaaaaacgaagggaaatcctttcaaggaggccttcctacaggaaaattttgaatgac
ttatcttctgatgcaccaggggtgccaaggattgaagaagaaaaatcagaagaagagact
tcagcccctgccatcaccactgtaacagtgccaaccccgatttaccaaactagcagtggg
cagtatattgccattacccagggaggagcaatacagctggctaacaatggtaccgatggg
gtacagggcctgcagacattaaccatgaccaatgcagctgccactcagccgggtactacc
attctacaatatgcacagaccactgatggacagcagattctagtgcccagcaaccaagtt
gttgttcaagctgcctctggtgatgtacaaacataccagattcgcacagcacccactagc
accattgcccctggagttgttatggcgtcctccccagcacttcctacacagcctgctgaa
gaagcagcacgaaagagagaggttcgtctaatgaagaacagggaagcagcaagagaatgt
cgtagaaagaagaaagaatatgtgaaatgtttagagaacagagtggcagtgcttgaaaac
caaaacaaaacattgattgaggagctaaaagcacttaaggacctttactgccacaagtca
gattaa

DBGET integrated database retrieval system