KEGG   Rattus norvegicus (rat): 81667Help
Entry
81667             CDS       T01003                                 

Gene name
Gnb2
Definition
(RefSeq) G protein subunit beta 2
  KO
K04537  guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04014  Ras signaling pathway
rno04062  Chemokine signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04371  Apelin signaling pathway
rno04713  Circadian entrainment
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04726  Serotonergic synapse
rno04727  GABAergic synapse
rno04728  Dopaminergic synapse
rno04926  Relaxin signaling pathway
rno05032  Morphine addiction
rno05034  Alcoholism
rno05167  Kaposi's sarcoma-associated herpesvirus infection
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    81667 (Gnb2)
   04371 Apelin signaling pathway
    81667 (Gnb2)
   04151 PI3K-Akt signaling pathway
    81667 (Gnb2)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    81667 (Gnb2)
  Endocrine system
   04926 Relaxin signaling pathway
    81667 (Gnb2)
  Nervous system
   04724 Glutamatergic synapse
    81667 (Gnb2)
   04727 GABAergic synapse
    81667 (Gnb2)
   04725 Cholinergic synapse
    81667 (Gnb2)
   04728 Dopaminergic synapse
    81667 (Gnb2)
   04726 Serotonergic synapse
    81667 (Gnb2)
   04723 Retrograde endocannabinoid signaling
    81667 (Gnb2)
  Environmental adaptation
   04713 Circadian entrainment
    81667 (Gnb2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    81667 (Gnb2)
  Substance dependence
   05032 Morphine addiction
    81667 (Gnb2)
   05034 Alcoholism
    81667 (Gnb2)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    81667 (Gnb2)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   81667 (Gnb2)
GTP-binding proteins [BR:rno04031]
 Heterotrimeric G-proteins
  Beta Subunits
   Beta [OT]
    81667 (Gnb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 WD40_like eIF2A CALM_bind Cytochrom_D1
Motif
Other DBs
NCBI-GeneID: 81667
NCBI-ProteinID: NP_112299
RGD: 69319
Ensembl: ENSRNOG00000001409
UniProt: P54313
Position
12q12
AA seq 340 aa AA seqDB search
MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYA
MHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNI
CSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGF
AGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYA
FTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAM
KGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagctggagcaactgagacaggaggctgagcagctccggaaccagatccgggac
gccagaaaagcatgcggggattccacactgacccagatcacagctgggctggacccagtg
gggcgaattcagatgagaacacggaggaccctccgtggacacctggcaaaaatctatgcc
atgcactgggggacagactcaaggctgctggtcagcgcctcccaggacggaaagctcatc
atttgggacagctacaccactaacaaggtccacgccatccctctgcgctcctcctgggtc
atgacctgtgcctacgccccctcggggaacttcgtggcctgtgggggtttggacaacatc
tgctccatctatagtctcaagacccgagagggcaatgtcagggtcagcagagagctgcct
ggccatactgggtacctctcctgctgccgcttcctggacgacaaccaaatcatcaccagc
tctggggacaccacctgtgccctgtgggacattgagacaggccagcagacagtgggattt
gctggacacagtggggatgtgatgtccctgtccctggcccccgatggccgcacctttgtg
tcaggtgcctgcgatgcctccatcaagctgtgggatgttcgggattccatgtgccgacag
acattcataggtcacgaatcggacatcaatgctgtggctttcttccccaatggttatgcc
ttcaccacgggatcagatgatgccacatgtcgcctgtttgacctgcgggctgatcaggag
ctgctcatgtattcccacgacaacatcatctgcggcatcacctcggttgccttctcacgc
agcggccggctgctgctcgctggctatgacgacttcaactgcaacatctgggatgccatg
aagggtgaccgtgcaggtgtcctcgctggccatgataaccgtgtgagctgccttggggtc
acagatgatgggatggctgtggctacaggctcctgggactccttcctcaagatctggaac
taa

DBGET integrated database retrieval system