KEGG   Rattus norvegicus (rat): 81667Help
Entry
81667             CDS       T01003                                 

Gene name
Gnb2
Definition
guanine nucleotide binding protein (G protein), beta polypeptide 2
Orthology
K04537  
guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
Organism
rno  Rattus norvegicus (rat)
Pathway
Ras signaling pathway
Chemokine signaling pathway
PI3K-Akt signaling pathway
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Morphine addiction
Alcoholism
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    81667 (Gnb2)
   04151 PI3K-Akt signaling pathway
    81667 (Gnb2)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    81667 (Gnb2)
  Nervous system
   04724 Glutamatergic synapse
    81667 (Gnb2)
   04727 GABAergic synapse
    81667 (Gnb2)
   04725 Cholinergic synapse
    81667 (Gnb2)
   04728 Dopaminergic synapse
    81667 (Gnb2)
   04726 Serotonergic synapse
    81667 (Gnb2)
   04723 Retrograde endocannabinoid signaling
    81667 (Gnb2)
  Environmental adaptation
   04713 Circadian entrainment
    81667 (Gnb2)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    81667 (Gnb2)
   05034 Alcoholism
    81667 (Gnb2)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   81667 (Gnb2)
GTP-binding proteins [BR:rno04031]
 Heterotrimeric G-proteins
  Beta Subunits
   Beta [OT]
    81667 (Gnb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
12q12
AA seq 340 aa AA seqDB search
MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYA
MHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNI
CSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGF
AGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYA
FTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAM
KGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagctggagcaactgagacaggaggctgagcagctccggaaccagatccgggac
gccagaaaagcatgcggggattccacactgacccagatcacagctgggctggacccagtg
gggcgaattcagatgagaacacggaggaccctccgtggacacctggcaaaaatctatgcc
atgcactgggggacagactcaaggctgctggtcagcgcctcccaggacggaaagctcatc
atttgggacagctacaccactaacaaggtccacgccatccctctgcgctcctcctgggtc
atgacctgtgcctacgccccctcggggaacttcgtggcctgtgggggtttggacaacatc
tgctccatctatagtctcaagacccgagagggcaatgtcagggtcagcagagagctgcct
ggccatactgggtacctctcctgctgccgcttcctggacgacaaccaaatcatcaccagc
tctggggacaccacctgtgccctgtgggacattgagacaggccagcagacagtgggattt
gctggacacagtggggatgtgatgtccctgtccctggcccccgatggccgcacctttgtg
tcaggtgcctgcgatgcctccatcaagctgtgggatgttcgggattccatgtgccgacag
acattcataggtcacgaatcggacatcaatgctgtggctttcttccccaatggttatgcc
ttcaccacgggatcagatgatgccacatgtcgcctgtttgacctgcgggctgatcaggag
ctgctcatgtattcccacgacaacatcatctgcggcatcacctcggttgccttctcacgc
agcggccggctgctgctcgctggctatgacgacttcaactgcaacatctgggatgccatg
aagggtgaccgtgcaggtgtcctcgctggccatgataaccgtgtgagctgccttggggtc
acagatgatgggatggctgtggctacaggctcctgggactccttcctcaagatctggaac
taa

DBGET integrated database retrieval system