KEGG   Rattus norvegicus (rat): 81687Help
Entry
81687             CDS       T01003                                 

Gene name
Mmp9
Definition
(RefSeq) matrix metallopeptidase 9
  KO
K01403  
matrix metalloproteinase-9 (gelatinase B) [EC:3.4.24.35]
Organism
rno  Rattus norvegicus (rat)
Pathway
Endocrine resistance
IL-17 signaling pathway
TNF signaling pathway
Leukocyte transendothelial migration
Estrogen signaling pathway
Relaxin signaling pathway
Hepatitis B
Pathways in cancer
Transcriptional misregulation in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Prostate cancer
Bladder cancer
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    81687 (Mmp9)
 Organismal Systems
  Immune system
   04657 IL-17 signaling pathway
    81687 (Mmp9)
   04670 Leukocyte transendothelial migration
    81687 (Mmp9)
  Endocrine system
   04915 Estrogen signaling pathway
    81687 (Mmp9)
   04926 Relaxin signaling pathway
    81687 (Mmp9)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    81687 (Mmp9)
   05202 Transcriptional misregulation in cancers
    81687 (Mmp9)
   05206 MicroRNAs in cancer
    81687 (Mmp9)
   05205 Proteoglycans in cancer
    81687 (Mmp9)
   05219 Bladder cancer
    81687 (Mmp9)
   05215 Prostate cancer
    81687 (Mmp9)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    81687 (Mmp9)
  Infectious diseases
   05161 Hepatitis B
    81687 (Mmp9)
  Drug resistance
   01522 Endocrine resistance
    81687 (Mmp9)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.35  gelatinase B
     81687 (Mmp9)
Peptidases [BR:rno01002]
 Metallo Peptidases
  Family M10
   81687 (Mmp9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RGD: 
Ensembl: 
UniProt: 
Position
3q42
AA seq 708 aa AA seqDB search
MNPWQPLLLVLLALGYSFAAPHQRQPTYVVFPRDLKTSNLTDTQLAEDYLYRYGYTRAAQ
MMGEKQSLRPALLMLQKQLSLPQTGELDSETLKAIRSPRCGVPDVGKFQTFEGDLKWHHH
NITYWIQSYTEDLPRDVIDDSFARAFAVWSAVTPLTFTRVYGLEADIVIQFGVAEHGDGY
PFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGAVVPTYFGNANGAPCHFPFTFEGR
SYLSCTTDGRNDGKPWCGTTADYDTDRKYGFCPSENLYTEHGNGDGKPCVFPFIFEGHSY
SACTTKGRSDGYRWCATTANYDQDKLYGFCPTRADVTVTGGNSAGEMCVFPFVFLGKQYS
TCTGEGRSDGRLWCATTSNFDADKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALM
YPMYHYHEDSPLHEDDIKGIQHLYGRGSKPDPRPPATTAAEPQPTAPPTMCPTAPPMAYP
TGGPTVAPTGAPSPGPTGPPTAGPSEAPTESSTPVDNPCNVDVFDAIADIQGALHFFKDG
RYWKFSNHGGSQLQGPFLIARTWPALPAKLNSAFEDPQSKKIFFFSGRKMWVYTGQTVLG
PRSLDKLGLGSEVTLVTGLLPRRGGKALLISRERIWKFDLKSQKVDPQSVTRLDNEFSGV
PWNSHNVFHYQDKAYFCHDKYFWRVSFHNRVNQVDHVAYVTYDLLQCP
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgaacccctggcagcccctgctcctggtgctcctggctctaggctacagctttgctgcc
cctcaccagcgccagccgacttatgtggtcttcccccgagacctgaaaacctccaacctc
acggacacacagctggcagaggattacctgtaccgctatggttacactcgggcagcccag
atgatgggagagaagcagtccctgcggcccgctttgctgatgcttcagaagcagctgtcc
ctgccccagactggtgagctggacagcgagacactaaaggccattcgttcaccgcgctgt
ggtgtcccagacgtgggcaaattccaaaccttcgaaggcgacctcaagtggcaccatcat
aacatcacctattggatccaaagctacaccgaagacttgccgcgagacgtgatcgatgac
tccttcgcgcgcgccttcgcggtgtggagcgcggtgacaccgctcaccttcacccgcgtg
tacgggctcgaagcagacattgtcatccagtttggtgtcgcggagcacggggacgggtat
cccttcgacggcaaggatggtctactggcacacgcctttccccctggccccggcattcag
ggagatgcccacttcgacgacgacgagttgtggtcgctgggcaaaggcgccgtggtcccc
acttactttggaaacgcaaatggtgccccatgtcactttcccttcaccttcgagggacgc
tcctatttgtcctgcaccacggatggccgcaacgacggcaagccttggtgtggcacgaca
gctgactacgacacagacagaaaatatggtttctgccccagtgagaatctctacacggag
catggcaacggagacggcaaaccctgcgtatttccattcatcttcgagggccactcctac
tctgcctgcaccactaaaggtcgctcggatggttatcgctggtgcgccaccaccgccaac
tatgaccaggataagctgtatggcttctgtcctactcgagccgacgtcactgtaactggg
ggcaactcggcaggagagatgtgcgtcttccccttcgtcttcctgggcaagcagtactct
acctgtaccggcgagggccgcagtgatgggcgcctctggtgcgcgacgacgtcgaacttc
gacgctgacaagaagtggggtttctgtccagaccaagggtacagcctgtttctggtggca
gcgcacgagttcggccatgcgctgggcttagatcattcttcagtgccggaagcgctcatg
taccccatgtatcactaccacgaggactcccctctgcatgaagacgacataaaaggcatc
cagcatctgtatggtcgtggctctaaacctgacccaaggcctccagccaccaccgcagct
gaaccacagccgacagctcctcccactatgtgtcccactgcacctcccatggcctatccc
acagggggccccacagtcgcccctacaggcgccccctcacctggccccacaggtccccct
actgctggtccttctgaggcccctacagagtcttcgactccagtagacaatccttgcaat
gtggatgtttttgatgccattgctgatatccagggcgctctgcatttcttcaaggacggt
cggtattggaagttctcgaatcacggaggaagccaattgcagggcccctttcttattgcc
cgcacgtggccagctttgcctgcaaagttgaactcagcctttgaggatccgcagtccaag
aagattttcttcttctctgggcgcaaaatgtgggtgtacacaggccagacggtgctgggc
cccaggagtctggataagttggggctaggctcagaggtaaccctggtcaccggacttctc
ccgcgtcgtggagggaaggctctgctgatcagccgggaacgtatctggaaattcgacttg
aagtctcagaaggtggatccccagagcgttactcgcttggataacgagttctctggcgtg
ccctggaactcacacaacgtctttcactaccaagacaaggcctatttctgccatgacaaa
tacttctggcgtgtgagtttccacaaccgggtgaaccaggtggaccacgtggcctacgtg
acctatgacctcctgcagtgcccttga

DBGET integrated database retrieval system