KEGG   Rattus norvegicus (rat): 81743Help
Entry
81743             CDS       T01003                                 

Gene name
Pde2a, Pde2, Pde2a2
Definition
(RefSeq) phosphodiesterase 2A
  KO
K18283  
cGMP-dependent 3',5'-cyclic phosphodiesterase [EC:3.1.4.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
Purine metabolism
cGMP-PKG signaling pathway
Olfactory transduction
Aldosterone synthesis and secretion
Morphine addiction
Module
cGMP signaling
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    81743 (Pde2a)
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    81743 (Pde2a)
 Organismal Systems
  Endocrine system
   04925 Aldosterone synthesis and secretion
    81743 (Pde2a)
  Sensory system
   04740 Olfactory transduction
    81743 (Pde2a)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    81743 (Pde2a)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     81743 (Pde2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q32
AA seq 935 aa AA seqDB search
MGQACGHSILCRSQQYPAARPAEPRGQQVFLKPDEPPPQPCADSLQDALLSLGAVIDIAG
LRQAAKDALSAVLPKVETVYTYLVDGESRLVCEDPPHELPQEGKIREAVISRKRLSCDGL
GPSDLLGKPLARLVAPLAPDTQVLVIPLLDKETGTVAAVILVHCGQLSDSEEQSLQVVEK
HALVALQRVQALQQRRPEAVQNTSADPSEDQKDEKGYTAHDRKILQLCGELYDLDATSLQ
LKVLRYLQQETQATHCCLLLVSEDNLQLSCKVIGEKVLGEEVSFPLTMGRLGQVVEDKQC
IQLKDLTSDDVQQLQNMLGCELRAMLCVPVISRATDQVVALACAFNKLGGDFFTDEDERA
IQHCFHYTGTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLS
NAEICSVFLLDQNELVAKVFDGGVVDDESYEIRIPADQGIAGHVATTGQILNIPDAYAHP
LFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCG
ISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFANFTY
TPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVS
HFCYLLYKNLELSNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSV
MERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAE
VGYDRNNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPM
EMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIR
GLPSNNSLDFLDEEYEVPDLDVTRAPVNGCCSLEG
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atggggcaggcatgcggccactccatcctctgcaggagccagcagtacccggcagcgcga
ccggctgagccgcggggccagcaggtcttcctcaagccggacgaaccgccgccgcagcca
tgcgccgacagcctgcaggatgctttgctgagcctgggcgccgttatcgacatcgcgggc
cttcgacaggctgccaaggatgccctctcggccgtgctccccaaagtggagactgtctac
acctacctggtagatggggagtccaggctggtgtgtgaggacccccctcatgagctgcca
caggaaggaaaaattcgagaggctgtgatttctcggaagcggctgagctgcgatgggctg
ggaccttcagacctactaggaaagcccttggccaggctggtggctccactggcccctgac
acgcaagtgctggtcatacccctgctggacaaggagactggaactgtggcagccgtcatc
ttggtgcactgtggccagctgagtgacagtgaggagcagagcctgcaggtggtggagaag
catgctctggtggccctgcagagggtgcaggccctgcagcagcgcaggcctgaagctgtt
cagaacacctcagcggatccctctgaagatcaaaaggatgagaagggatacaccgcccat
gaccgaaagatcctgcaactgtgtggagaactctatgacttggatgccacttctctgcag
ctcaaagtccttcgatatcttcagcaggagacacaggccactcactgctgcctcctgctg
gtgtcagaggacaacctgcagctttcctgcaaggtcattggagagaaagtgctgggagaa
gaggtcagctttccattgaccatgggacgcctgggccaggtggtggaggacaaacagtgt
atccagttgaaggacctaacctctgacgatgtgcaacagctacaaaacatgttgggctgt
gagcttcgggctatgctatgtgtccctgtcatcagtcgagccactgaccaggtggtggcc
ctggcttgcgccttcaacaagcttggaggagacttcttcacagatgaggatgaacgtgcg
atccaacactgcttccactacacaggcacggtgctcaccagtaccttggccttccagaag
gagcagaagctcaagtgtgagtgccaggctcttctccaagtggcaaagaacctcttcacc
cacctggatgacgtctctgtcctgctacaggagatcatcacagaggccagaaacctcagc
aacgcagagatctgctccgtgttcctgctggatcagaatgagctggttgccaaggtgttc
gatggcggtgtagtggacgatgagagttatgagatccgcatccctgcggaccaaggcatc
gcgggccacgtggcgaccacgggccagatcctgaacatcccagatgcatacgcccatccg
cttttctatcgcggcgtagacgacagcactggcttccgcacgcgcaacattctctgcttc
cctatcaagaacgagaaccaagaggtcatcggtgtggctgagctagtgaacaagatcaat
gggccatggttcagcaaatttgatgaggacctggccacagccttctccatctactgtggc
attagcatcgctcactctctcctatacaaaaaggtgaatgaagcccagtaccgcagccac
ctggccaacgagatgatgatgtaccatatgaaggtctctgacgatgaatacaccaaactt
ctccatgatggcatccaacctgtggccgccattgactccaactttgccaacttcacctat
actcctcggtctctgcctgaggacgatacttctatggccatcctgagcatgctgcaagac
atgaacttcatcaataactacaaaattgactgcccaactctggcccggttctgcctgatg
gtgaagaaaggctaccgggatccgccctaccacaactggatgcacgccttctctgtctct
cacttttgctacttgctctacaagaatctggagctctccaactacctcgaggacatcgag
atctttgcgttgtttatttcctgcatgtgtcacgacctggaccacagaggcacaaacaac
tccttccaggtggcctcgaaatctgtgctggctgcactctacagctcagagggctctgtc
atggagaggcaccactttgctcaggccattgctatcctcaacacccatggctgtaatatc
tttgaccacttctctcggaaggactatcagcgaatgctggacctgatgagggacatcatc
ttggccacggacctggcacaccacctccgcatcttcaaggacctgcagaagatggctgaa
gtgggttatgaccgaaacaacaagcaacaccacaggcttcttctatgcctccttatgacc
tcctgtgacctctctgaccagacaaagggctggaagaccaccagaaagattgcggagctg
atctacaaagagttcttctcccaaggagacttggagaaggccatgggcaaccgaccaatg
gagatgatggatcgggagaaggcctacatccctgaacttcagatcagctttatggagcac
atcgccatgcccatctacaagctgttacaagacctgttccccaaggcagcagagctgtat
gaacgcgtggcctccaatcgtgagcactggaccaaggtgtcccacaagttcaccatccga
ggcctccccagtaacaactcgctggatttcctggatgaggaatatgaggtccctgatttg
gacgtcaccagggctcctgtcaatggctgctgcagcctcgagggctga

DBGET integrated database retrieval system