KEGG   Rattus norvegicus (rat): 81814Help
Entry
81814             CDS       T01003                                 

Gene name
Tmsb4x
Definition
thymosin, beta 4, X chromosome
Orthology
K05764  
thymosin, beta 4
Organism
rno  Rattus norvegicus (rat)
Pathway
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:rno00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    81814 (Tmsb4x)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
X
AA seq 44 aa AA seqDB search
MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
NT seq 135 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaaacccgatatggctgagatcgagaaattcgataagtcgaagttgaagaag
acagaaacacaagagaaaaatcctctgccttcaaaagaaacaattgaacaagagaagcaa
gctggcgaatcgtaa

DBGET integrated database retrieval system