KEGG   Rattus norvegicus (rat): 83500Help
Entry
83500             CDS       T01003                                 

Gene name
Slc22a8, OCT3, Oat3, Roct
Definition
(RefSeq) solute carrier family 22 member 8
  KO
K08205  
MFS transporter, OCT family, solute carrier family 22 (organic anion transporter), member 8
Organism
rno  Rattus norvegicus (rat)
Pathway
Bile secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Digestive system
   04976 Bile secretion
    83500 (Slc22a8)
Transporters [BR:rno02000]
 Solute Carrier Family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   83500 (Slc22a8)
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    83500 (Slc22a8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q43
AA seq 536 aa AA seqDB search
MTFSEILDRVGSMGPFQYLHVTLLALPVLGIANHNLLQIFTATTPVHHCRPPPNASIGPW
VLPLDPNGKPEKCLRFVHLPNASLPNDTQRATEPCLDGWIYNSTRDTIVIEWDLVCSSNK
LKEMAQSIFMAGILVGGPVIGELSDRFGRKPILTWSYLMLAASGSGAAFSPSLPVYMIFR
FLCGCSISGISLSTVILNVEWVPTSMRAISSTSIGYCYTIGQFILSGLAYAIPQWRWLQL
TSSAPFFIFSLLSWWVPESIRWLVLSGKYSKALKTLQRVATFNGKKEEGKKLTIEELKFN
LQKDITSAKVKYGLSDLFRVSILRRVTFCLSLAWFSTGFAYYSLAMGVEEFGVNIYILQI
IFGGVDIPAKFITILSLSYLGRRITQSFLLLLAGGAILALIFVPSEMQLLRTALAVFGKG
CLSGSFSCLFLYTSELYPTVLRQTGMGISNVWARVGSMIAPLVKITGELQPFIPNVIFGT
TALLGGSAAFFLLETLNRPLPETIEDIQNWHKQVQKTKQESEAEKASQIIPLKTGG
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgaccttctccgagattctggaccgtgtcggaagcatgggccccttccagtacctgcat
gtgaccttgctggccctcccagtcctcggaatagccaaccacaacttgctacagatcttc
acagccaccacccctgtccaccactgtcgcccgccccccaacgcctctatagggccctgg
gtactccccttggacccaaatgggaagcctgagaagtgtctccgcttcgtacatctgcca
aatgccagtcttcccaatgacacccagagggccaccgagccgtgcttggatggctggatc
tacaacagcaccagagacaccattgtgatagagtgggacttggtgtgcagctccaacaaa
ctgaaggagatggcccagtcgatcttcatggcaggcatactggttggaggacctgtgatt
ggagaactgtcagacaggtttggccgcaagcctatcctgacctggagttatctcatgctg
gcagccagcggctctggtgctgccttcagtcccagcctccctgtctatatgatcttccga
ttcctgtgtggctgcagcatctcgggcatttctctgagcaccgttatcttgaatgtggaa
tgggtacccacctcgatgcgggccatctcatcaacatctattgggtactgctacaccatt
ggtcagttcattctgtccggcctggcctatgccattcctcagtggcgctggctacagtta
acctcgtctgctcccttcttcatcttctccttgttgtcctggtgggtaccagagtccata
cgctggctggttctatctggaaaatactcaaaggccctgaagacactccaacgggtggct
accttcaacggcaagaaggaggaagggaaaaagctcaccatagaggagctgaagttcaac
ttgcagaaggacatcacctcagccaaggtcaaatatggcttatctgacttgttccgggtg
tccatccttcgtcgtgtgaccttctgtctctctctggcctggttttctactggttttgcc
tactacagtttggctatgggggtagaagaatttggagtcaacatctacatactccagatt
atctttggtggggttgacatcccagccaagttcatcacaatcctctccttaagttatctg
ggccggcgcatcactcagagcttcctcctgctcctagcaggaggggccattttggccctc
atctttgtgccttcagaaatgcagctcttgagaacagcactggctgtgtttggaaaggga
tgcctatctggctccttcagctgcctcttcctctacacgagtgagctctaccctacagtc
ctcaggcaaacaggtatgggtatcagtaacgtgtgggctcgagtaggaagtatgatagcc
ccactggtgaaaatcacgggtgaactgcagcccttcatccctaatgtcatctttgggacc
acggccctactgggaggcagtgctgccttctttctgcttgagaccctcaatcggccctta
ccggagactatcgaggacatacaaaactggcacaagcaagtccagaaaacaaagcaggag
tcggaagcagaaaaggcatcccaaataatcccgctgaagactggtggatag

DBGET integrated database retrieval system