KEGG   Rattus norvegicus (rat): 83505Help
Entry
83505             CDS       T01003                                 

Gene name
St3gal5, Siat9
Definition
ST3 beta-galactoside alpha-2,3-sialyltransferase 5 (EC:2.4.99.9)
Orthology
K03370  
lactosylceramide alpha-2,3-sialyltransferase (sialyltransferase 9) [EC:2.4.99.9]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Module
Glycosphingolipid biosynthesis, ganglio series, LacCer => GT3
Class
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:rno00604]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
4q33
AA seq 387 aa AA seqDB search
MPNEFTSAKLRSDCSRTSLQWYTQTQHKMRRPSLLLKDILKCMLVVFGVWLLYILKLNYT
AEECDMKKLNYVDPARIKRAHRNTQEVFQKECRPGHAKKTMDLLFKGKYSMDLEPFVQKI
PTASEAELKYDPPFGFRKFSSKVQSLLDMLPEHDFPEHLRAKHCKRCVVIGNGGILHGLE
LGHALNQFDVVIRLNSAPIEGYSEHVGNKTTIRMTYPEGAPLSDAEYYANDLFVAVLFKS
VDFKWLQAMVKNESLPFWIRLFFWKQVAEKIPLQPKHFRILNPVIIKETAFDILQYSEPQ
SRFWGHDKNIPTIGIIAIVLATHLCDEVSLAGFGYDLSQPRTPLHYFDSQCMGAMNWQVM
HNVTTETQFLQKLIKEGVVQDLSGGIH
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgccaaatgagttcacctctgcaaagctgagaagtgattgctcaaggacctccctgcaa
tggtacacccagacccagcacaagatgagaagacccagcttgttattaaaagacatcctc
aagtgcatgttggttgtgtttggagtgtggctcctgtacatcctcaagttaaattacact
gctgaagaatgtgacatgaaaaaactgaattatgtagaccctgcccgaataaagagagct
catagaaacactcaggaagtctttcagaaggaatgtcgtcctgggcacgcgaagaaaact
atggatctgttatttaagggcaagtacagcatggacttggagcctttcgtgcagaagatc
cccacagccagtgaagctgagctcaagtatgacccgccttttggattccggaagttctcc
agtaaagtccagagcctcttggatatgctgcctgagcacgactttcctgaacacttgaga
gccaagcactgcaagcgctgtgtggttattgggaacgggggcatccttcacggactagag
ctgggccacgcactcaaccagttcgatgtggtaataaggttaaacagcgcaccaattgag
ggttattctgaacatgttggaaataaaactactataaggatgacttacccagagggtgct
ccactgtcggacgctgaatactacgctaatgacttgttcgttgctgttttatttaagagt
gttgatttcaaatggcttcaagcaatggtgaaaaatgaaagcctgccattttggattcgt
ctcttcttttggaagcaggtggcagaaaaaatcccactccagccaaagcatttcaggatt
ttgaacccagttatcatcaaagaaactgccttcgacatccttcagtactcagagcctcag
tcaagattctggggccatgataagaatatccccacgatcggcatcattgccattgtcttg
gccacgcatctgtgtgatgaagttagcctggcaggctttggatatgacctcagtcaacca
aggacccctctgcactactttgacagtcagtgcatgggcgccatgaactggcaagtcatg
cacaacgtgaccacagagacccagttcctccagaagctcatcaaggagggcgtggtgcag
gacctcagcgggggcatccactga

DBGET integrated database retrieval system