KEGG   Rattus norvegicus (rat): 83510Help
Entry
83510             CDS       T01003                                 

Gene name
Lypla2
Definition
lysophospholipase II (EC:3.1.1.5)
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    83510 (Lypla2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     83510 (Lypla2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
5q36
AA seq 231 aa AA seqDB search
MCGNNMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAP
RIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGG
FSQGGALSLYTALTCPHPLAGIVALSCWLPLHRNFPQAANGSAKDLAILQCHGELDPMVP
VRFGALTAEKLRTVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtaacaacatgtctgtgcccctgctcaccgacgcagccaccgtgtccggagct
gagcgggaaacggccgcggttatttttttacatggacttggagacacagggcacagctgg
gctgacgccctctccaccatccggcttcctcatgtcaagtacatctgtccccatgcgccc
aggattcctgtgacactcaacatgaagatggtaatgccctcctggtttgacctgatgggg
ctgagtccagatgccccagaggatgaagctggcatcaagaaggccgcagagaacatcaag
gctttgattgaacacgagatgaagaacgggattcctgccaaccgaatcgtcctgggtggc
ttttcgcagggtggggccctgtccctctatacagcacttacctgcccccaccctctggcc
ggcatcgtggctttgagctgctggctgcctctgcaccggaacttcccccaagcagccaat
ggcagtgccaaggacctggccatccttcaatgccacggcgagctggaccccatggtacct
gttcggtttggggccctgacagctgagaagctccggacagttgtcacacctgccagggtc
cagtttaagacatacccaggtgtcatgcacagctcctgtcctcaggagatggcagctgta
aaggaatttctggagaaacttctgcctccggtctaa

DBGET integrated database retrieval system