KEGG   Rattus norvegicus (rat): 83574Help
Entry
83574             CDS       T01003                                 

Gene name
Rxrg
Definition
(RefSeq) retinoid X receptor gamma
  KO
K08526  retinoid X receptor gamma
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03320  PPAR signaling pathway
rno04659  Th17 cell differentiation
rno04919  Thyroid hormone signaling pathway
rno04920  Adipocytokine signaling pathway
rno04928  Parathyroid hormone synthesis, secretion and action
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05216  Thyroid cancer
rno05222  Small cell lung cancer
rno05223  Non-small cell lung cancer
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Immune system
   04659 Th17 cell differentiation
    83574 (Rxrg)
  Endocrine system
   04920 Adipocytokine signaling pathway
    83574 (Rxrg)
   03320 PPAR signaling pathway
    83574 (Rxrg)
   04919 Thyroid hormone signaling pathway
    83574 (Rxrg)
   04928 Parathyroid hormone synthesis, secretion and action
    83574 (Rxrg)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    83574 (Rxrg)
   05202 Transcriptional misregulation in cancers
    83574 (Rxrg)
   05226 Gastric cancer
    83574 (Rxrg)
   05216 Thyroid cancer
    83574 (Rxrg)
   05222 Small cell lung cancer
    83574 (Rxrg)
   05223 Non-small cell lung cancer
    83574 (Rxrg)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    83574 (Rxrg)
Nuclear receptors [BR:rno03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   83574 (Rxrg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Motif
Other DBs
NCBI-GeneID: 83574
NCBI-ProteinID: NP_113953
RGD: 620046
Ensembl: ENSRNOG00000004537
UniProt: Q5BJR8
Position
13q24
AA seq 463 aa AA seqDB search
MYGNYSHFMKFPTGFGGSPGHTGSTSMSPSVALPTGKPMDSHPSYTDTPVSAPRTLSAVG
TPLNALGSPYRVITSAMGPPSGALAAPPGINLVVPPSSQLNVVNSVSSSEDIKPLPGLPG
IGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKD
CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECASTGHEDMPVERIL
EAELAVEPKTESYGDMSVESSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
MRMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgtatggaaattactcccacttcatgaagtttcccaccggctttggtggctcccctggt
cacactggctccacatccatgagcccatcggtagccttgcccacagggaagccgatggac
agtcatcccagctacacagataccccagtgagtgccccacggacgctgagtgctgtggga
acccccctcaatgctctcggctctccgtatagagtcatcacttctgccatgggtccaccc
tcaggagccctggcagctcctccgggaatcaacttggtggttccacccagctctcagctc
aatgtggtcaacagtgtcagcagctccgaggacatcaagcccttaccaggtctgcctggg
atcggaaatatgaactacccatccaccagccccgggtctctggtgaaacacatctgtgcc
atctgtggggacagatcctcaggaaagcactacggggtgtatagctgtgaaggctgcaaa
ggcttcttcaagagaaccataaggaaagacctcatctacacgtgtcgggataacaaagac
tgtctcatcgacaagcgccagcgcaaccgttgccagtactgtcgttaccagaagtgcctg
gtcatgggcatgaagagggaagctgtgcaagaagaaaggcagaggagccgggagcgagca
gagagtgaggcagaatgtgccagtactggccatgaagacatgccggtggagaggattcta
gaagctgagcttgctgtggaaccaaagaccgaatcctacggcgacatgagtgtggagagc
tcgacaaatgaccctgtcaccaatatatgccacgctgcggataagcagctcttcaccctt
gttgagtgggccaaacgcatcccccacttctcagacctcaccttggaggaccaggtcatt
ctgctccgggcagggtggaatgaattgctgattgcctccttctcccaccgctcggtttct
gtccaggatggcatcctgctggccacaggcctccacgtccacaggagcagcgctcacagc
gcgggcgtcggctccatctttgacagagtcctcacagagctggtgtccaagatgaaggac
atgcggatggataagtcggagctcgggtgcctgcgcgccattgtgctgttcaatccagat
gccaagggtttgtccaacccctcggaggtggagactcttcgagagaaggtttatgccacc
ctcgaggcctataccaagcagaagtatccagaacagcctggcaggtttgccaagcttctg
ctgcgcctcccagctctgcgctccattggattgaaatgcctggaacacctcttcttcttc
aagctcattggggatacccccattgacaccttcctcatggagatgttggagacccctctg
cagatcacctga

DBGET integrated database retrieval system