KEGG   Rattus norvegicus (rat): 83574Help
Entry
83574             CDS       T01003                                 

Gene name
Rxrg
Definition
retinoid X receptor gamma
Orthology
K08526  
retinoid X receptor gamma
Organism
rno  Rattus norvegicus (rat)
Pathway
PPAR signaling pathway
Thyroid hormone signaling pathway
Adipocytokine signaling pathway
Pathways in cancer
Transcriptional misregulation in cancer
Thyroid cancer
Small cell lung cancer
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    83574 (Rxrg)
   03320 PPAR signaling pathway
    83574 (Rxrg)
   04919 Thyroid hormone signaling pathway
    83574 (Rxrg)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    83574 (Rxrg)
   05202 Transcriptional misregulation in cancers
    83574 (Rxrg)
   05216 Thyroid cancer
    83574 (Rxrg)
   05222 Small cell lung cancer
    83574 (Rxrg)
   05223 Non-small cell lung cancer
    83574 (Rxrg)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    83574 (Rxrg)
Nuclear receptors [BR:rno03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   83574 (Rxrg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
13q24
AA seq 463 aa AA seqDB search
MYGNYSHFMKFPTGFGGSPGHTGSTSMSPSVALPTGKPMDSHPSYTDTPVSAPRTLSAVG
TPLNALGSPYRVITSAMGPPSGALAAPPGINLVVPPSSQLNVVNSVSSSEDIKPLPGLPG
IGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKD
CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECASTGHEDMPVERIL
EAELAVEPKTESYGDMSVESSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
MRMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgtatggaaattactcccacttcatgaagtttcccaccggctttggtggctcccctggt
cacactggctccacatccatgagcccatcggtagccttgcccacagggaagccgatggac
agtcatcccagctacacagataccccagtgagtgccccacggacgctgagtgctgtggga
acccccctcaatgctctcggctctccgtatagagtcatcacttctgccatgggtccaccc
tcaggagccctggcagctcctccgggaatcaacttggtggttccacccagctctcagctc
aatgtggtcaacagtgtcagcagctccgaggacatcaagcccttaccaggtctgcctggg
atcggaaatatgaactacccatccaccagccccgggtctctggtgaaacacatctgtgcc
atctgtggggacagatcctcaggaaagcactacggggtgtatagctgtgaaggctgcaaa
ggcttcttcaagagaaccataaggaaagacctcatctacacgtgtcgggataacaaagac
tgtctcatcgacaagcgccagcgcaaccgttgccagtactgtcgttaccagaagtgcctg
gtcatgggcatgaagagggaagctgtgcaagaagaaaggcagaggagccgggagcgagca
gagagtgaggcagaatgtgccagtactggccatgaagacatgccggtggagaggattcta
gaagctgagcttgctgtggaaccaaagaccgaatcctacggcgacatgagtgtggagagc
tcgacaaatgaccctgtcaccaatatatgccacgctgcggataagcagctcttcaccctt
gttgagtgggccaaacgcatcccccacttctcagacctcaccttggaggaccaggtcatt
ctgctccgggcagggtggaatgaattgctgattgcctccttctcccaccgctcggtttct
gtccaggatggcatcctgctggccacaggcctccacgtccacaggagcagcgctcacagc
gcgggcgtcggctccatctttgacagagtcctcacagagctggtgtccaagatgaaggac
atgcggatggataagtcggagctcgggtgcctgcgcgccattgtgctgttcaatccagat
gccaagggtttgtccaacccctcggaggtggagactcttcgagagaaggtttatgccacc
ctcgaggcctataccaagcagaagtatccagaacagcctggcaggtttgccaagcttctg
ctgcgcctcccagctctgcgctccattggattgaaatgcctggaacacctcttcttcttc
aagctcattggggatacccccattgacaccttcctcatggagatgttggagacccctctg
cagatcacctga

DBGET integrated database retrieval system