KEGG   Rattus norvegicus (rat): 83731Help
Entry
83731             CDS       T01003                                 

Gene name
Kcnma1, BKCa, KCNMA1b, KCNMA1c, Kcnma, Slo, cbv1
Definition
(RefSeq) potassium calcium-activated channel subfamily M alpha 1
  KO
K04936  
potassium large conductance calcium-activated channel subfamily M alpha member 1
Organism
rno  Rattus norvegicus (rat)
Pathway
cGMP-PKG signaling pathway
Vascular smooth muscle contraction
Insulin secretion
Renin secretion
Salivary secretion
Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    83731 (Kcnma1)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    83731 (Kcnma1)
   04924 Renin secretion
    83731 (Kcnma1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    83731 (Kcnma1)
  Digestive system
   04970 Salivary secretion
    83731 (Kcnma1)
   04972 Pancreatic secretion
    83731 (Kcnma1)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  K+ channel, KCNM, KCa1.x
   83731 (Kcnma1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
15p16
AA seq 1243 aa AA seqDB search
MANGGGGGGGGSSGSSGGGGGGGGGETALRMSSNIHANHLSLDASSSSSSSSSSSSSSSS
SVHEPKMDALIIPVTMEVPCDSRGQRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCC
HCGGKTKEAQKINNGSSQADGTLKPVDEKEEVVAAEVGWMTSVKDWAGVMISAQTLTGRV
LVVLVFALSIGALVIYFIDSSNPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDK
LWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIK
LVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVY
AKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLE
SVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARV
KIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPS
WNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVSN
EMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRSRKRILINPGNHLKTQ
EGTLGFFIASDAKEVKRAFFYCKACHDDVTDPKRIKKCGCRRLIYSKMSIYKRMSRACCF
DCGRSERDCSCMSGRVRGNVDTLERNFPLSSVSVNDCSTSFRAFEDEQPPTLSPKKKQRN
GGMRNSPNTSPKLMRHDPLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSE
AAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWET
LHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNIDDTSLQDKECILASLNIKS
MQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQ
FLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPEL
EALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFADLGDGGCYGDLFCKALKTYNM
LCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQFDHNAGQSRASLSHS
SHSSQSSSKKSSSVHSIPSTANRPNRPKSRESRDKQKKEMVYR
NT seq 3732 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacggtggcggcggcggcggcggcggcagcagcggcagcagcggcggcggcggc
ggcggcggcggaggcgagacggctcttagaatgagcagcaatatccacgcgaaccatctc
agcctagacgcgtcctcttcttcctcctcctcttcttcctcctcctcttcctcctcgtcc
tcggtccacgagcccaagatggatgcgctcatcatcccggtgaccatggaggtgccgtgc
gacagccggggccaacgcatgtggtgggctttcttggcctcctccatggtgactttcttc
gggggcctcttcatcatcttgctctggcggactctcaagtacctgtggaccgtttgctgc
cactgcgggggcaagacgaaggaggcccagaagataaacaatggctccagccaggcagat
ggtactctcaagccagtggatgaaaaagaggaggtggtggcagccgaggtcggctggatg
acatctgtgaaggactgggcaggggtgatgatatctgcccagacactgactggcagagtc
ctggttgtgttagtctttgctctcagcattggtgcccttgtaatatacttcatagactca
tcaaacccaatagaatcctgccagaatttctacaaagatttcacattacagatcgacatg
gctttcaacgtgttcttccttctctactttggcttgcggtttattgcagccaatgataag
ctgtggttctggctggaagtgaattctgtagtagatttcttcacagtccctcccgtgttt
gtgtctgtatacttaaacagaagttggcttggcttgagatttttaagagctctcagactg
attcagttttcagaaattttgcagtttctgaatatccttaaaacaagtaattccatcaag
ctggtgaacctgctctccatatttatcagcacgtggctgactgcagctggattcatccac
ttggtggagaattcaggggacccatgggaaaatttccaaaacaaccaggcacttacgtac
tgggaatgtgtctacttactcatggtcacaatgtctacagtgggttacggggatgtttat
gcaaaaaccacgcttggacgcctcttcatggtcttcttcatcctcgggggactggccatg
tttgccagctacgtccctgaaatcatagagttaataggaaaccgcaagaaatacgggggc
tcctatagcgcggttagtggaagaaagcacattgtagtctgtgggcacattactctggag
agtgtctctaacttcctgaaggactttctgcacaaggaccgggatgatgtcaacgtggag
attgtttttcttcacaacatctcccctaaccttgagcttgaggctctgttcaaacggcat
ttcactcaggtggagttttatcagggctctgtcctcaatccacacgatcttgccagagtc
aagatagagtcagcagatgcatgtttgatccttgccaataagtactgcgctgacccggat
gcagaagatgcctccaacatcatgagagtgatctccataaagaactaccacccaaagatc
aggatcatcactcagatgctgcagtatcacaacaaggcccatctgctcaacatccccagc
tggaactggaaagagggtgatgacgcaatatgccttgcagagctcaagttgggtttcata
gcccagagctgtctggctcaaggcctctccacaatgcttgccaatctcttctctatgagg
tcattcataaagattgaggaagatacatggcagaaatactacttggaaggagtctccaat
gaaatgtacacagaatatctttccagtgccttcgtgggtctgtccttccctactgtttgt
gagctgtgttttgtgaagcttaagctcctgatgatagccattgagtacaagtctgccaac
agggagagccgaagccgaaagcgaatattaattaaccctgggaaccaccttaagacccaa
gaaggtactttaggatttttcatcgcaagtgatgccaaagaagttaaaagggcatttttt
tactgcaaggcctgtcatgatgacgtcacagatcccaaaagaattaaaaaatgcggctgc
aggcggctgatctattccaagatgtccatctacaagagaatgagccgagcatgttgtttt
gattgcggacgttctgagcgtgactgctcgtgcatgtcaggccgtgtgcgtggtaacgtg
gacacccttgagagaaacttcccgctttcttctgtctctgttaatgattgctccaccagt
ttccgtgcctttgaagatgagcaaccgccaacactgtcaccaaaaaaaaaacaacgtaat
gggggcatgaggaactcacccaacacatccccgaagctgatgaggcatgaccccttgtta
attcctggcaacgatcagattgacaacatggactccaatgtgaaaaagtacgactccact
ggaatgtttcactggtgcgcacccaaggagattgagaaagtcatcttgactcgaagtgaa
gctgccatgactgtcctgagtggtcatgttgtagtctgcatctttggggatgtcagctca
gccctgattggcctccggaacctggtgatgccgcttcgtgctagcaattttcactatcat
gagctcaaacacattgtgtttgtgggctccatcgagtacctcaagcgggagtgggaaaca
ctgcacaacttccccaaagtatccatattgcctggtacgccattaagtcgggctgattta
agggctgtcaacatcaacctctgtgacatgtgcgttatcctgtcagccaatcagaataat
attgatgatacttcgcttcaggacaaggaatgcatcttggcgtcactcaacatcaaatct
atgcagtttgatgacagcatcggggtcttgcaggctaattcccaaggattcacacctcct
ggaatggacagatcatcacctgacaacagcccagtgcacgggatgttacgccagccgtcc
atcacaaccggagtcaacattcccatcatcacggaactcgtgaacgatactaatgttcag
tttttggaccaagatgatgatgatgaccctgacacagagctgtacctcacacagcccttt
gcttgtgggacagcatttgccgttagcgtcctggactcactcatgagcgcgacatacttc
aatgacaatatcctcaccctaatacggaccctggtgacaggaggagccacgccagagctc
gaagctttaatagctgaggagaatgcacttcgagggggttacagcactccgcagacacta
gccaacagggaccgctgccgagtggcccagttagccctgttggatgggccctttgcggac
ttaggggatggtggttgttatggtgatctgttctgcaaagctctgaaaacatataacatg
ctttgttttggaatttaccggctgagagatgcccacctcagcacccccagccagtgtaca
aaaaggtacgtcatcaccaatcccccctacgagtttgaacttgtaccgacagacctgatc
ttctgcctgatgcagtttgaccacaacgctggccaatcccgggccagtctgtctcattcc
tcccactcctcacagtcgtccagtaagaagagctcctctgtccactccatcccgtccaca
gcaaatcggccaaaccggcccaagtccagggagtcccgcgacaaacagaaaaaagaaatg
gtttacagatga

DBGET integrated database retrieval system