KEGG   Rattus norvegicus (rat): 83790Help
Entry
83790             CDS       T01003                                 

Gene name
Cyp2c23
Definition
(RefSeq) cytochrome P450, family 2, subfamily c, polypeptide 23
  KO
K07413  cytochrome P450 family 2 subfamily C [EC:1.14.14.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00140  Steroid hormone biosynthesis
rno00590  Arachidonic acid metabolism
rno00591  Linoleic acid metabolism
rno00830  Retinol metabolism
rno01100  Metabolic pathways
rno04726  Serotonergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
rno05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    83790 (Cyp2c23)
   00590 Arachidonic acid metabolism
    83790 (Cyp2c23)
   00591 Linoleic acid metabolism
    83790 (Cyp2c23)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    83790 (Cyp2c23)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    83790 (Cyp2c23)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    83790 (Cyp2c23)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    83790 (Cyp2c23)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     83790 (Cyp2c23)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP2 family
   83790 (Cyp2c23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 CDC50
Motif
Other DBs
NCBI-GeneID: 83790
NCBI-ProteinID: NP_114027
RGD: 620370
Ensembl: ENSRNOG00000013291
UniProt: Q68G40
Position
1q54
AA seq 494 aa AA seqDB search
MELLGFTTLALVVSVTCLSLLSVWTKLRTRGRLPPGPTPLPIIGNLLQLNLKDIPASLSK
LAKEYGPVYTLYFGTSPTVVLHGYDVVKEALLQQGDEFLGRGPLPIIEDTHKGYGLIFSN
GERWKVMRRFSLMTLRNFGMGKRSLEERVQEEARCLVEELQKTKAQPFDPTFILACAPCN
VICSILFNDRFQYNNKTFLNLMDLLNKNFQQVNSVWCQMYNLWPTIIKYLPGKHIEFAKR
IDDVKNFILEKVKEHQKSLDPANPRDYIDCFLSKIEEEKDNLKSEFHLENLAVCGSNLFT
AGTETTSTTLRFGLLLLMKYPEVQAKVHEELDRVIGRHQPPSMKDKMKLPYTDAVLHEIQ
RYITLLPSSLPHAVVQDTKFRDYVIPKGTTVLPMLSSVMLDQKEFANPEKFDPGHFLDKN
GCFKKTDYFVPFSLGKRACVGESLARMELFLFFTTLLQKFSLKTLVEPKDLDIKPITTGI
INLPPPYKLCLVPR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggagctgctgggattcactacgcttgctctcgtggtttcggtgacttgcctcagcctc
ctttcagtgtggacaaaactgcgcactagggggaggctgcccccgggccccacccccctt
cccattattgggaatctactgcaactgaacctcaaggacatccctgcatcgctttccaag
ctggccaaagagtacgggcctgtttacacgctgtactttggaacctctcctactgtggtc
ctacatggctatgatgtggtgaaggaggcgcttctccagcaaggggatgagttcctcggg
agaggacctctgcccatcatcgaagatacccataagggatatggactcattttcagtaat
ggagagaggtggaaagtcatgcgacgcttctccctcatgactctgaggaacttcggaatg
gggaagagaagcctagaggagagggtgcaggaggaagcccggtgccttgtggaggaatta
caaaaaacaaaagctcagccctttgaccccaccttcatcctggcctgtgctccctgcaac
gtgatctgctccattcttttcaacgatcgattccagtacaacaacaagacgttcctcaac
cttatggatcttttaaataaaaattttcaacaagtgaactccgtgtggtgccagatgtac
aacctttggccaacgatcataaagtatctccctggaaagcatatagaatttgcaaaaaga
attgatgatgttaaaaacttcattcttgaaaaagtgaaggaacaccagaagtccctggat
cctgccaaccctcgggactacattgactgttttctcagcaagattgaggaggagaaggac
aacctgaagtctgagttccatctggagaacttggctgtctgtgggtctaacttgtttacg
gcaggcaccgagacaaccagcaccaccctgagattcgggctcctgctccttatgaagtat
ccagaggtgcaagccaaagttcatgaggaacttgaccgtgtgattggacgccaccaaccc
cccagcatgaaggacaagatgaagctgccttataccgatgctgtattgcatgagattcaa
agatacatcactctccttccttccagtctgccccatgctgtggtccaggacacaaaattc
agagactatgtcatccccaagggtactactgtactcccgatgctgtcttccgtcatgctg
gatcaaaaggagtttgccaacccagagaagtttgatccaggacactttctggataaaaat
ggctgcttcaagaagacagactactttgttcccttctcccttggaaagcgggcctgtgtt
ggtgagagtttggcccggatggagctcttcctgttcttcaccacccttctgcaaaagttt
tccctgaagactctggtggagcccaaggaccttgacatcaagcctattactaccgggatt
atcaatttgccgccaccttacaagctgtgccttgttcctagataa

DBGET integrated database retrieval system