KEGG   Rattus norvegicus (rat): 83805Help
Entry
83805             CDS       T01003                                 

Gene name
Src
Definition
(RefSeq) SRC proto-oncogene, non-receptor tyrosine kinase (EC:2.7.10.2)
  KO
K05704  
tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
EGFR tyrosine kinase inhibitor resistance
ErbB signaling pathway
Rap1 signaling pathway
Chemokine signaling pathway
Endocytosis
Axon guidance
VEGF signaling pathway
Focal adhesion
Adherens junction
Tight junction
Gap junction
Platelet activation
GABAergic synapse
Inflammatory mediator regulation of TRP channels
Regulation of actin cytoskeleton
GnRH signaling pathway
Estrogen signaling pathway
Prolactin signaling pathway
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Bacterial invasion of epithelial cells
Tuberculosis
Hepatitis B
Viral carcinogenesis
Proteoglycans in cancer
Bladder cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    83805 (Src)
   04012 ErbB signaling pathway
    83805 (Src)
   04370 VEGF signaling pathway
    83805 (Src)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    83805 (Src)
  Cell motility
   04810 Regulation of actin cytoskeleton
    83805 (Src)
  Cellular commiunity
   04510 Focal adhesion
    83805 (Src)
   04520 Adherens junction
    83805 (Src)
   04530 Tight junction
    83805 (Src)
   04540 Gap junction
    83805 (Src)
 Organismal Systems
  Immune system
   04611 Platelet activation
    83805 (Src)
   04062 Chemokine signaling pathway
    83805 (Src)
  Endocrine system
   04912 GnRH signaling pathway
    83805 (Src)
   04915 Estrogen signaling pathway
    83805 (Src)
   04917 Prolactin signaling pathway
    83805 (Src)
   04921 Oxytocin signaling pathway
    83805 (Src)
   04919 Thyroid hormone signaling pathway
    83805 (Src)
  Nervous system
   04727 GABAergic synapse
    83805 (Src)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    83805 (Src)
  Development
   04360 Axon guidance
    83805 (Src)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    83805 (Src)
   05203 Viral carcinogenesis
    83805 (Src)
   05219 Bladder cancer
    83805 (Src)
  Infectious diseases
   05152 Tuberculosis
    83805 (Src)
   05100 Bacterial invasion of epithelial cells
    83805 (Src)
   05161 Hepatitis B
    83805 (Src)
  Antineoplastic resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    83805 (Src)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     83805 (Src)
Protein kinases [BR:rno01001]
 Tyrosine protein kinases
  Src family
   83805 (Src)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
3q42
AA seq 542 aa AA seqDB search
MGSNKSKPKDASQRRRSLEPAENVHGAGGAFPASQTPSKPASADGHRGPNAAFVPPAAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTRKV
DVREGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGT
FLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYS
KHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTR
VAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLK
GETGKYLRLPQLVDMSAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLI
EDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREV
LDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGE
NL
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcaacaagagcaagcccaaggacgccagccagaggcgccgcagcctggagccc
gcggagaacgtgcatggggcaggtggcgccttccctgcctcacagacaccaagcaagcct
gcctccgccgatggccaccgcgggcccaatgccgcctttgtgccccccgcggccgccgag
cccaagctcttcggaggcttcaactcctcggacactgtcacctccccacaaagggcgggg
cctctggcaggtggggtgactacctttgtggccctctatgactatgagtcacggacagag
actgacctgtccttcaagaaaggggagcggctgcagattgtcaataacacgaggaaggtg
gatgtcagagagggagactggtggctggcacactcgctgagcaccggacagaccggttac
atccccagtaactatgtggcgccctccgactccatccaggctgaggagtggtactttggc
aagatcactagacgggaatcagagcggctacttctcaacgccgagaaccccagagggacc
ttcctcgtgagggagagtgagaccacaaaaggtgcctactgcctctctgtatccgacttt
gacaatgccaagggcctaaatgtgaaacactacaagatccggaaactggacagtggcgga
ttctacatcacctcccgcacgcaattcaacagcctgcagcagcttgtggcttactactcc
aaacatgctgatggcctgtgtcaccgtctcactaccgtgtgtcccacatccaagcctcag
acccagggcctggccaaggatgcgtgggagatcccccgggagtccctgcggctggaggtc
aagctgggccagggttgcttcggagaggtgtggatggggacctggaacggcaccacgagg
gttgccatcaaaaccctgaagccaggcaccatgtctccagaggccttcctgcaggaggcc
caagtcatgaagaaactgaggcatgagaagctggtgcagctgtatgccgtggtgtcagaa
gaacccatttacattgtgacagagtacatgaacaaggggagtctgctggactttctcaag
ggggaaacgggcaaatacttgcggctaccccagctggtggacatgtctgctcagattgct
tcaggcatggcctatgtggagcggatgaactatgtgcaccgggacctccgagccgccaat
atcctggttggcgagaacctggtgtgcaaagtggccgactttgggctggcccggctcata
gaggacaacgaatacacagctcggcaaggtgccaaattccccatcaagtggaccgcccct
gaagcggctctgtatggcaggttcaccatcaagtcggacgtgtggtcctttggaatcctg
ctgactgagctcaccactaagggcagagtgccctatcctgggatggtgaaccgagaggtg
ctggaccaggtagagcggggctaccggatgccttgtccccccgagtgccctgagtccctg
catgacctcatgtgccagtgctggcggaaggagcctgaggagcggcccaccttcgagtac
ctgcaggccttcctggaggactactttacgtccacggagccgcagtaccagcccggggag
aacctatag

DBGET integrated database retrieval system