KEGG   Rattus norvegicus (rat): 83808Help
Entry
83808             CDS       T01003                                 

Gene name
Ugt2b15, Ugt2b12, Ugt2b36, Ugt2b4
Definition
UDP glucuronosyltransferase 2 family, polypeptide B15 (EC:2.4.1.17)
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Bile secretion
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    83808 (Ugt2b15)
   00053 Ascorbate and aldarate metabolism
    83808 (Ugt2b15)
   00500 Starch and sucrose metabolism
    83808 (Ugt2b15)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    83808 (Ugt2b15)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    83808 (Ugt2b15)
   00860 Porphyrin and chlorophyll metabolism
    83808 (Ugt2b15)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    83808 (Ugt2b15)
   00982 Drug metabolism - cytochrome P450
    83808 (Ugt2b15)
   00983 Drug metabolism - other enzymes
    83808 (Ugt2b15)
 Organismal Systems
  Digestive system
   04976 Bile secretion
    83808 (Ugt2b15)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    83808 (Ugt2b15)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     83808 (Ugt2b15)
Glycosyltransferases [BR:rno01003]
 Others
  Hydrophobic molecule
   83808 (Ugt2b15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
14p21
AA seq 530 aa AA seqDB search
MPGKWISALLLLQISFCFKSGNCGKVLVWPMEYSHWMNIKIILEELVQKGHEVTVLRPSA
SVFLDPKETSDLKFVTFPTSFSSHDLENFFTRFVNVWTYELPRDTCLSYFLYLQDTIDEY
SDYCLTVCKEAVSNKQFMTKLQESKFDVVFSDAIGPCGELIAELLQIPFLYSLRFSPGYT
IEKYIGGVLFPPSYVPMIFSGLAGQMTFIERVHNMICMLYFDFWFQTFREKKWDPFYSKT
LGRPTTLAEIMGKAEMWLIRSYWDLEFPHPISPNVDYIGGLHCKPAKPLPKDIEDFVQSS
GEHGVVVFSLGSMVRNMTEEKANIIAWALAQIPQKVLWRFDGKKPPTLGPNTRLYKWLPQ
NDLLGHPKTKAFVTHGGANGIYEAIHHGIPMIGIPLFGEQHDNIAHMVAKGAAVEVNFRT
MSKSDMLNALEEVINNPFYKKNAMWLSTIHHDQPTKPLDRAVFWIEFVMRHKGAKHLRSL
GHNLPWYQYHSLDVIGFLLTCVAVTVVLALKCFLFVYRFFVKKEKKTKNE
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgcctgggaagtggatttctgctctgctcctgctgcaaataagtttctgctttaaatct
gggaactgcggaaaggtgttggtatggccgatggaatatagtcactggatgaatataaag
ataatactagaggaacttgtacagaagggccatgaagtcactgttctgagaccttcagct
tctgtctttcttgatcccaaggaaacttctgaccttaaatttgtaacttttcctacatct
ttcagtagtcatgacctggaaaatttttttacaaggtttgtgaatgtatggacttatgag
ttgccaagagacacatgtttgtcatattttctttatctacaagatacgattgatgaatat
tctgactactgtctgactgtttgtaaagaagcagtttcaaacaaacagttcatgacaaaa
ctacaggaatccaaatttgatgtcgttttctcagatgccattggtccctgtggagagctg
atagctgaactgctccagattccttttctgtacagtcttcgcttctctcctggctacaca
attgaaaagtacattggaggagttctattccctccctcttatgtacctatgattttttca
ggattagctggccaaatgacattcatagagagggtacacaatatgatatgtatgctttat
tttgacttttggttccaaacatttagagagaagaaatgggatccattttacagcaaaact
ttaggaaggcccaccacattagctgagataatgggcaaagcagaaatgtggctcattaga
tcctactgggatttggagtttccccacccaatatcgccaaatgttgactacattggagga
ctccactgcaaacctgctaaacccttgcccaaggatattgaagacttcgtccagagctct
ggagagcatggtgtggtggtgttttctctggggtcaatggtcaggaacatgacagaagaa
aaggccaacatcattgcatgggcccttgcccagattccacaaaaggttctttggagattt
gacggcaaaaaaccacccaccttaggacccaataccagactctacaagtggcttccccaa
aatgatcttcttggtcatccaaaaaccaaagcctttgtaacgcatggtggagccaatggc
atctatgaggcgatccatcatggaatccctatgattggcattcccctatttggagagcaa
catgataacattgcccacatggtggccaaaggagcagctgtggaagtaaatttcaggaca
atgtcaaagtcagatatgctcaatgcactggaggaagtcataaacaatcctttttataaa
aagaatgctatgtggttgtcaaccattcaccatgaccagcctacgaagccactggacaga
gctgtcttctggattgagtttgtcatgcgccacaaaggggccaagcacctgagatcactt
ggacataaccttccctggtaccagtaccactctctggatgtgattggattcctgctcacc
tgtgtggcagtcactgtagtccttgctctaaagtgctttttatttgtttatcgattcttt
gtaaagaaggaaaagaaaacaaagaatgagtag

DBGET integrated database retrieval system