KEGG   Rattus norvegicus (rat): 83810Help
Entry
83810             CDS       T01003                                 

Gene name
Trpv1, TRPV1_SON, VR.5'sv, Vr1, Vr1l1
Definition
(RefSeq) transient receptor potential cation channel, subfamily V, member 1
  KO
K05222  
transient receptor potential cation channel subfamily V member 1
Organism
rno  Rattus norvegicus (rat)
Pathway
Neuroactive ligand-receptor interaction
Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    83810 (Trpv1)
 Organismal Systems
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    83810 (Trpv1)
Ion channels [BR:rno04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPV (Vanilloid)
   83810 (Trpv1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q24
AA seq 838 aa AA seqDB search
MEQRASLDSEESESPPQENSCLDPPDRDPNCKPPPVKPHIFTTRSRTRLFGKGDSEEASP
LDCPYEEGGLASCPIITVSSVLTIQRPGDGPASVRPSSQDSVSAGEKPPRLYDRRSIFDA
VAQSNCQELESLLPFLQRSKKRLTDSEFKDPETGKTCLLKAMLNLHNGQNDTIALLLDVA
RKTDSLKQFVNASYTDSYYKGQTALHIAIERRNMTLVTLLVENGADVQAAANGDFFKKTK
GRPGFYFGELPLSLAACTNQLAIVKFLLQNSWQPADISARDSVGNTVLHALVEVADNTVD
NTKFVTSMYNEILILGAKLHPTLKLEEITNRKGLTPLALAASSGKIGVLAYILQREIHEP
ECRHLSRKFTEWAYGPVHSSLYDLSCIDTCEKNSVLEVIAYSSSETPNRHDMLLVEPLNR
LLQDKWDRFVKRIFYFNFFVYCLYMIIFTAAAYYRPVEGLPPYKLKNTVGDYFRVTGEIL
SVSGGVYFFFRGIQYFLQRRPSLKSLFVDSYSEILFFVQSLFMLVSVVLYFSQRKEYVAS
MVFSLAMGWTNMLYYTRGFQQMGIYAVMIEKMILRDLCRFMFVYLVFLFGFSTAVVTLIE
DGKNNSLPMESTPHKCRGSACKPGNSYNSLYSTCLELFKFTIGMGDLEFTENYDFKAVFI
ILLLAYVILTYILLLNMLIALMGETVNKIAQESKNIWKLQRAITILDTEKSFLKCMRKAF
RSGKLLQVGFTPDGKDDYRWCFRVDEVNWTTWNTNVGIINEDPGNCEGVKRTLSFSLRSG
RVSGRNWKNFALVPLLRDASTRDRHATQQEEVQLKHYTGSLKPEDAEVFKDSMVPGEK
NT seq 2517 nt NT seq  +upstreamnt  +downstreamnt
atggaacaacgggctagcttagactcagaggagtctgagtccccaccccaagagaactcc
tgcctggaccctccagacagagaccctaactgcaagccacctccagtcaagccccacatc
ttcactaccaggagtcgtacccggctttttgggaagggtgactcggaggaggcctctccc
ctggactgcccttatgaggaaggcgggctggcttcctgccctatcatcactgtcagctct
gttctaactatccagaggcctggggatggacctgccagtgtcaggccgtcatcccaggac
tccgtctccgctggtgagaagcccccgaggctctatgatcgcaggagcatcttcgatgct
gtggctcagagtaactgccaggagctggagagcctgctgcccttcctgcagaggagcaag
aagcgcctgactgacagcgagttcaaagacccagagacaggaaagacctgtctgctaaaa
gccatgctcaatctgcacaatgggcagaatgacaccatcgctctgctcctggacgttgcc
cggaagacagacagcctgaagcagtttgtcaatgccagctacacagacagctactacaag
ggccagacagcactgcacattgccattgaacggcggaacatgacgctggtgaccctcttg
gtggagaatggagcagatgtccaggctgcggctaacggggacttcttcaagaaaaccaaa
gggaggcctggcttctactttggtgagctgcccctgtccctggctgcgtgcaccaaccag
ctggccattgtgaagttcctgctgcagaactcctggcagcctgcagacatcagcgcccgg
gactcagtgggcaacacggtgcttcatgccctggtggaggtggcagataacacagttgac
aacaccaagttcgtgacaagcatgtacaacgagatcttgatcctgggggccaaactccac
cccacgctgaagctggaagagatcaccaacaggaaggggctcacgccactggctctggct
gctagcagtgggaagatcggggtcttggcctacattctccagagggagatccatgaaccc
gagtgccgacacctatccaggaagttcaccgaatgggcctatgggccagtgcactcctcc
ctttatgacctgtcctgcattgacacctgtgaaaagaactcggttctggaggtgatcgct
tacagcagcagtgagacccctaaccgtcatgacatgcttctcgtggaacccttgaaccga
ctcctacaggacaagtgggacagatttgtcaagcgcatcttctacttcaacttcttcgtc
tactgcttgtatatgatcatcttcaccgcggctgcctactatcggcctgtggaaggcttg
cccccctataagctgaaaaacaccgttggggactatttccgagtcaccggagagatcttg
tctgtgtcaggaggagtctacttcttcttccgagggattcaatatttcctgcagaggcga
ccatccctcaagagtttgtttgtggacagctacagtgagatacttttctttgtacagtcg
ctgttcatgctggtgtctgtggtactgtacttcagccaacgcaaggagtatgtggcttcc
atggtgttctccctggccatgggctggaccaacatgctctactatacccgaggattccag
cagatgggcatctatgctgtcatgattgagaagatgatcctcagagacctgtgccggttt
atgttcgtctacctcgtgttcttgtttggattttccacagctgtggtgacactgattgag
gatgggaagaataactctctgcctatggagtccacaccacacaagtgccgggggtctgcc
tgcaagccaggtaactcttacaacagcctgtattccacatgtctggagctgttcaagttc
accatcggcatgggcgacctggagttcactgagaactacgacttcaaggctgtcttcatc
atcctgttactggcctatgtgattctcacctacatccttctgctcaacatgctcattgct
ctcatgggtgagaccgtcaacaagattgcacaagagagcaagaacatctggaagctgcag
agagccatcaccatcctggatacagagaagagcttcctgaagtgcatgaggaaggccttc
cgctctggcaagctgctgcaggtggggttcactcctgacggcaaggatgactaccggtgg
tgtttcagggtggacgaggtaaactggactacctggaacaccaatgtgggtatcatcaac
gaggacccaggcaactgtgagggcgtcaagcgcaccctgagcttctccctgaggtcaggc
cgagtttcagggagaaactggaagaactttgccctggttccccttctgagggatgcaagc
actcgagatagacatgccacccagcaggaagaagttcaactgaagcattatacgggatcc
cttaagccagaggatgctgaggttttcaaggattccatggtcccaggggagaaataa

DBGET integrated database retrieval system