KEGG   Rattus norvegicus (rat): 83817Help
Entry
83817             CDS       T01003                                 

Gene name
Ache
Definition
acetylcholinesterase (EC:3.1.1.7)
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glycerophospholipid metabolism
Cholinergic synapse
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:rno00564]
Organismal Systems; Nervous system; Cholinergic synapse [PATH:rno04725]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
12
AA seq 614 aa AA seqDB search
MRPPWYPLHTPSLASPLLFLLLSLLGGGARAEGREDPQLLVRVRGGQLRGIRLKAPGGPV
SAFLGIPFAEPPVGSRRFMPPEPKRPWSGILDATTFQNVCYQYVDTLYPGFEGTEMWNPN
RELSEDCLYLNVWTPYPRPTSPTPVLIWIYGGGFYSGASSLDVYDGRFLAQVEGTVLVSM
NYRVGTFGFLALPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASV
GMHILSLPSRSLFHRAVLQSGTPNGPWATVSAGEARRRATLLARLVGCPPGGAGGNDTEL
ISCLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPDALINTGDFQDLQVLVG
VVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPE
DPAHLRDAMSAVVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGY
EIEFIFGLPLDPSLNYTVEERIFAQRLMQYWTNFARTGDPNDPRDSKSPRWPPYTTAAQQ
YVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKN
QFDHYSKQERCSDL
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgaggcctccctggtatcccctgcatacaccctccctggcttctccactcctcttcctc
ctcctctccctcctgggaggaggggcaagggctgagggccgggaagaccctcagctgctg
gtgagggttcgagggggccagctgaggggcatccgcctgaaggcccctggaggcccagtc
tcagcttttctgggcatcccctttgcagagccacctgtgggctcacgtagatttatgcca
ccagagcccaagcgcccctggtcaggaatattggatgctaccaccttccaaaatgtctgc
taccaatacgtggacaccctgtaccctgggtttgagggtaccgagatgtggaaccccaat
cgagagctgagtgaagactgcctttatcttaatgtgtggacaccataccccaggcctact
tctcccacacctgtcctcatctggatctatgggggtggtttctacagtggagcatcctcc
ttggacgtgtatgacggccgtttcctggcccaggttgagggaaccgtgttggtatctatg
aactaccgagtgggaacctttggcttcttggctctaccaggaagcagagaagcccctggc
aatgtaggcctgctggatcaacggcttgccttgcaatgggtacaagaaaatatcgcagcc
tttgggggagacccaatgtcagtgactctgtttggggagagtgcaggtgcagcctcagtg
ggcatgcacattctgtccctgcccagcaggagcctcttccacagggctgtcctgcagagt
ggcacacccaatgggccctgggccactgtgagtgcgggagaggccaggcgcagggccaca
ctgctggcccgccttgtgggctgtcccccaggtggcgctggtggcaatgacaccgagctg
atatcctgcttgaggacaaggcccgctcaggacctggtggaccacgagtggcatgtgctg
cctcaagaaagtatcttccggttttccttcgtgcctgtggtggacggggatttcctcagt
gacacgccggacgctctcatcaatactggagattttcaagacctgcaggtgctggtgggt
gtggtgaaggacgagggctcctactttctggtttacggggtcccaggcttcagcaaagac
aatgaatctctcatcagccgggcccagttcctggctggggtgcggatcggtgtaccccaa
gcgagtgacctggcggccgaggctgtggtcctgcattatacagactggctgcaccctgag
gaccctgcccacctgagagatgccatgagtgcggtggtaggcgaccacaacgttgtgtgc
cctgtggcccagctggctgggcgactggctgcccaaggggctcgggtctatgcctacatc
tttgaacaccgtgcctccacattgacttggcccctctggatgggggtgccccatggctat
gaaatcgagttcatctttgggctccccctggatccctcactgaactacaccgtggaggag
agaatctttgctcagcgacttatgcaatactggaccaattttgcccgcacaggggacccc
aatgaccctcgagactctaagtctccacggtggccaccgtacaccactgccgcgcagcaa
tacgtgagcctgaacctgaagcctttggaggtgcggcggggactgcgcgcccagacctgc
gccttctggaatcgttttctccccaaattgctcagcgccacagacacgctggacgaggcg
gagcgccagtggaaggccgagttccaccgctggagctcctacatggtgcactggaagaac
cagttcgaccactatagcaagcaggaacgctgctcagacctgtga

DBGET integrated database retrieval system