KEGG   Rattus norvegicus (rat): 84015Help
Entry
84015             CDS       T01003                                 

Gene name
Ttn
Definition
(RefSeq) titin
  KO
K12567  
titin [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Hypertrophic cardiomyopathy (HCM)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    84015 (Ttn)
   05414 Dilated cardiomyopathy (DCM)
    84015 (Ttn)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     84015 (Ttn)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: CAMK group
  MLCK family
   84015 (Ttn)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     84015 (Ttn)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   84015 (Ttn)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Position
3q23
AA seq 24017 aa AA seqDB search
MTTQAPTFTQPLQSVVVLEGSAATFEAHISGSPVPEVSWFRDGQVISTSTLPGVQISFSD
GRARLMIPAVTKANSGRYSLRATNGSGQATSTAELLVTAETAPPNFSQRLQSMTVRQGSQ
ARLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATN
SVGRATSTADLLVQGEEVVPAKKTKTIVSTAQISETRQTRTEKKIEAHFDARSIATVEMV
IDGATGQLPHKTPPRIPPKPKSRSPTPPSIAAKAQLARQQSPSPIRHSPSPVRHVRAPTP
SPVRSVSPAGRISTSPIRSVKSPLLIRKTQTTTVATGPEVPPPWKQEGYVASSTEAEMRE
TTMTSSTQIRREERWEGRYGVQEQVTISGAAGTAASVSARSSFTAEAVTTGAKEVKQETD
KSAAVATVVAAVDMARVREPVISAVEQTAQRTTTTAVHVQPAQKQMRKEAEKTAVTKVVV
AADKAKEQELRLRTREEIITKQEQTHIAHEQIRKETEKAFVPKVVISATKAKEQETRITG
EITTKQEQKRITQETLRQETETIAASVVVATAKSTKLEAAVGIQEETAIQQDQTHLTHGQ
VGVGKKAEAVATVVAAVDQARVREPREPRHVEESYSQQTTLEYGYKEHISATKVPEQPQR
PASEPHVVPKAVKPVVIQAPSETHIKATDQVGMHISSQASIAGSAIATLQKELSTTSSTQ
KITKSVKAPTVKPGETRVRAEPTPSPKFPFADVPAPDTYKSQAGIEVKKEVGVSISGSTV
REEQFELLRGREAKVTETARVPAPAEVPVTPPTLVSGLKNVTVVEGESVTLECHISGYPS
PKVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLA
VQVSEEFDKETTLTEKFTTEEKRFVESRDVVMTDTSITEEQAGPGEPAAPFFISKPVVQK
LVEGGSVVFECQIGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECRLVISMTFADDAG
EYTIVIRNKHGETSASASLLEEDAGTLPPDALQVQAASVLGTEDSGRLENVLLASGEQRH
LTSRLVLPADYEALIKSQQETLYQTQMSTFIQEPKVGEIAPGFAYSEYEKEYEKEQALIR
KKMAKDTVMVRTFVEDQEFHISSFEERLIKEIEYRIIKTTLEELLEEDGEERMAVDISES
EAVESGFDIRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIRRGERYQMDFLQDGR
ASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLYVEPAAPFSAPTYMPTPEAVSRIRSVS
PRSVSRSPIRISPAMSPARMSPARMSPARMSPARMSPGRRLEETDESQLERLYKPVFVLK
PASFKCLEGQTARFDLKVVGRPMPETFWFHNGQQIVNDYTHKVVIKEDGTQSLIIVPALP
SDSGEWTVVAQNRAGKSTISVTLTVEAVEHQIKPAFVEKLKNVNIKEGSRLEMKVRATGN
PNPDIVWLKNSDIIVPHKYPRIRIEGTKGEAALKIDSTISQDSAWYTATAINKAGRDTTR
CKVNIEVEFAEPEPERRLIIPRGTYRAKEISAPELEPLHLRYGQEQWEEGDLYDKEKQQK
PFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRLINEFGYCSL
DYEAAYSRDSGVITCRATNKYGTDHTSATLIVKDEKSLVEESQLPEGKKGLQRIEELERM
AHEGALTGVTTDQKEKQKPDIVLFPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIR
KSKRFRVRYDGIHYLDIVDCKSYDTGEVKVTAENPEGVTEHKVKLEIQQREDFRSVLRRA
PEPKPEFHVHEPGKLQFEVQKVDRPVDTGETKEVVKLKRAERITHEKVSEESEELRSKFK
RRTEEGYYEAITAVELKSRKKDESYEELLKKTKDELLHWTKELTEEEKKALAEEGKVTIP
TFKPERIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSD
RIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQD
VVAKEKDTMATFECETSEPFVKVKWYKDGIEVHAGDKYRMHSDRKVHFLSVLTIDTSDAE
DYSCVLVEDENIKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECIISPENIEGKWYHN
DVELKSNGKYSITSRRGRQNLTVKDVTKEDQGEYCFVVDGKKTTCKLKMKPRPIAILQGL
SDQKVCEGDIVQLEVKVSLENVEGVWMKDGQEVQHSDRVHIVIDKQSHMLLIEDMTKEDA
GNYSFTIPALGLSTSGNVSVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLND
EQIKPDDRVQSIVKGTKQRLVINRTHASDEGPYKLMVGRVETSCNLSVEKIKIIRGLRDL
TCTETQNVVFEVELSHSGIDVVWNFKGQEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGEY
AFYAGENTTSGKLTVAGGAISKPLTDQTVAESQEAVFECEVANPESEGEWLKDGKHLTLS
NNFRSESDGHKRRLVIAAAKLDDIGEYTYKVATSKTSAKLKVEAVKIKKTLRNLTVTETQ
DAIFSVELTHPDVKGVQWIKNGVVLDSNDKYEISVKGTLYSLKIKNCAMADESVYGFKLG
RLGASARLHVETVKIIKKPKDVTALENATVAFEVSVSHDTVPVKWFHKNVEIKPSDKHRL
VSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFVETLHITKTMRNIEVPETKAASFE
CEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSA
TLTVTPIMITSMLKDINAEEKDTITFEVTVNYEGISYKWLKNGVEIKSTDRCQMRTKKLT
HSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRKHIKDIKVLEKKRAMFECEVS
EPDITVQWMKDGQELQIVDRIKIQKEKYVHRLLIPSARMSDAGKYTVVAGGNMSTANLFV
EGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVEERHQYVVERRI
HRMFISEARHSDAGEYTFVAGRNRSSVTLYVNAPEPPQVLQELQPVTVQSGKPARFCAVI
AGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATT
SASLSVEVPEVVSPDQEMPVYPPAIVTPLQDAVTSEGRPARFQCQVSGTDLKVSWYCRDK
KIKPSRFFRMTQFEDTYQLEIAEAFPEDEGTYAFVANNAVGQVSSTATLRLEAPESILHE
QIGQQIEMEMKEIASILSAKEDFQTYSSDLPNENGTLELLSGPPAHSTQFDSRQEGAVPV
FIKEISDVEISIEDVAKLSVTVVGCPKPKIQWFFNGMLLTPSADYKFVFDGNNHSLIILF
TRFQDEGEYTCMASNEYGRAVCSAHLKVSPKGERSKDKGSVVKETLEKPEEPCLPYFLKE
LKPVHCAPGIPAVFEYLVHGEPAPTVLWFKEDMPLYTNVCYTIIHNPDGSGTFIVNDPQR
GDSGLYICKAENLWGTSTCTAELLVLPEDTDVPDASCKEESTSGVPGDFLETSARGLSVQ
AFDSEQEITAFAKGALVAEEKLQLPYEHKVDSSELGTGVTLGAQKLQPVIMSTLQGTGEL
PSIDGAVHTQPGKEPPPTLHLQTVQSQRTLPKEDTLQFEEPEELCPGASSAAQVSSVTVK
PLITLTAEPKGKSPQSSTAAPDGSLLSSVTEETLHLGEKMILEVDKEQRALLLSQSIAEG
CVESLEALDVAVSEVRSEPQVPSQHTCIEEGKTLMASADTLESTGQNVALRTEEGKSLSF
PLALEEKQVLLKEEQSEVMAVPTSQTSKPKKEPEAVKGVKEVQESDLLSKETLFSSIPKE
QRLHLKTQVRRALQAAVAREQASLFSEWLRNIDKVEVTAVNFTQEPKRILCTYLITSVKS
LTEELTLTIEDIDPQMANLETELKDALCSIVCEERNILMAEDPRFQEEDKIGVQAGRGHL
SDAQKVETVIEAEVDSKYLVPKEEVSWLNVESHFKDGDTDEVPQTETLKVAEEGDTQKTS
TVRSQEEAEGPLADLCPTILKPLVDTISEKGDTVHLTSSISNAKEVNWYFKGDLVPPGAK
FQCLKEENAYTLVIESVKTEDEGEYVCEASNGNGKAMTSAKLTVGERAAPVIKRRIEPLE
VALGHLAKFTCEIQGAPNVRFQWFKAGREIYESDKCSIRSSNYISSLEILRTQVVDCGEY
TCKASNEYGSVSCTATLTVTEAYPPTFLSRPKSLTTFVGKAAKFLCTVSGTPVIETIWQK
DGTALSPSPDCRITDADNKHSLELSNLTVQDRGVYSCKASNKFGADICQAELTIIDKPHF
IKELEPVQSAINKKIHLECQVDEDRKVSITWSKDGQKLPAGKDYKIYFEDKIASLEIPLA
KLKDSGTYSCTASNEAGSSSSSATVAVREPPSFVKKVDPSYLMLPGESARLHCKLKGSPV
IQVTWFKNNKELSESNTVRMSFANSEAILDITDVKVDDSGTYSCEATNDAGSDSCSTEVV
IKEPPSFIKTLEPAHIVRGANALLQCEVAGTGPFEVSWFKDKKQIRSSKKYRLFTQKTFV
FLEITSFNSADIGDYECVVANEVGKCGCVATHLLKEPPTFVKKVDDFTALAGQTVTLQAA
VRGSEPISVMWMKGQEVIKEDGKIKMSFSSGVAVLTISDVQIGLGGKYTCLAENEAGSQT
SVGELIVKEPAKIIERAELIQVTAGDPATLEYTVSGTPELKPKWYKDGRPLVASKKYRIS
FKNNIAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLDRDIAPLFTKPLRNVDSVV
GGACRLDCKIAGSLPMRVSWFKDGKEIAASDRYQIAFVEGTASLEISRVDMNDAGNFTCR
ATNSVGSKDSRGALIVQEPPSFVTKPESRDVLPGSAVCLKSAFQGSTPLTIRWFKGDKEL
VSGGSCYITKEASESSLELYAVKTTDSGTYTCKVSNVAGSVECSANLFVKGLHSSFDTFG
RPRDPFYISVFLFSTALLNNSLPSTEPATFTEKLEPSQLLKKGDATQLVCKVTGTPPIKI
TWFANDRELRESSKHKMSFVESTAVLRLTDVAIEDSGEYMCEAQNEAGSDHCTSIVIVKE
SPYFTKEFKSIEVLKEYDVMLLAEVAGTPPFEITWFKDNTTLRSGRKYKTFIQDQLVSLQ
ILKFVASDAGEYQCRVTNEVGSSTCSARVTLREPPSFIKKIETTSSLRGGTAAFQATLKG
SLPITVTWLKDNDEITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSA
LLSVKEPATITEEAVSIDVTQGDPATLQVKFSGTKEISAKWFKDGQELTLGPKYKISVTD
TVSILKIISTEKKDSGEYTFEVQNDVGRSSCKASINVLDLIIPPSFTKKLRKMDSIKGSF
IDLECIVAGSHPISIQWFKDDQEISASDKYKFSFHDNTAFLEISQLEGTDSGTYTCSATN
KAGHSQCSGHLTVKEPPYFVEKPQSQDVNPSTRVQLKALVGGTAPMTIKWFKDNKELHPG
AARSVWKDDTSTILELFSAKAADSGTYICQLSNDVGTTSSKATIFVKEPPQFIKKPSPVL
VLRNGQSTTFECQVTGTPEIRVSWYLDGNEITDLRRYGISFVDGLATFQISNARVENSGT
YVCEARNDAGTASCSIELKVKEPPIFIRELEPVEVVKDSDVELECEVMGTTPFEVTWLKN
NKEIRSGKKYTMSEKMSVFYLHITKCAPSDVGEYQCIIANEGGSCACTARVALKEPPSFI
KKIENVTTVLKSSATFQSTVAGSPPISITWLKDDQILEENDNVHISFEDSVATLQVRSVD
NGHSGRYTCQAKNESGVERCYAFLLVQEPAQIIEKAKSVDVTEKDPVTLECVVAGTPELK
VKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVL
DQDIPPSFTKKLTKMDKVLGSSIHMECKVSGSLPINAQWFKDGKEISTSAKYRLVCHENT
VSLEVSNLELEDTANYTCKVSNVAGDNACSGILTVKEPPSFLVKPERQQAIPDSTVEFKA
VLKGTPPFKIKWLKDDVELVSGPKCFIGLEGSTSFLNLYSVDASKTGQYTCQVTNDVGSD
SCTTMLLVTEPPKFVKKLEASKIVKAGDSARLECKITGSPEIRVVWYRNEHELTASDKYQ
MTFIDSVAVMQMNSLGTEDSGDFICEAQNPAGSTSCSTKVIVKEPPVFSSFPPVVETLKN
TEVSLECELSGTPPFEVVWYKDKRQLRSSKKYKIASKNFHASIHILNVDSTDIGEYHCKA
QNEVGSDTCICAIKLKEPPKFISKLNSLTVVAGEPAELQASIEGAPPISVHWLKEKEEVV
RESENVRISFVNNVATLQFAKAEPANAGKYICQVKNDGGVRENMASLTVLEPAVIVEKAG
SMTVTVGETCSLECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLKILSVEKEDA
GTYTFQVQNNVGKSSCTAVVDVSDRMVPPSFTRRLKDIGGVLGTSCVLECKVAGSSPISI
AWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGSYTCVAANVAGSDECRALLTVQE
PPSFVKEPEPLEILPGKNITFTSVIRGTPPFKVGWFRGARELVKGDRCNIYFEDTVAELE
LFNIDVSQSGEYTCVVSNNAGQASCTTRLFVKEPATFVKKLSDHSVEPGKSIILEGTYTG
TLPISVTWKKDGVVITPSERCNIVTTEKTCILEILTSTKGDAGHYSCEIENEAGRDSCDA
LVSTLERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIHVCWYRDGVLLRDDENLQMS
FVDNVATLKILQTDLSHSGQYSCSASNPLGTASSTARLTAREPKKSPFFDIKPVSIDVIA
GESADFECHVTGAQPMRVTWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQ
ATNDVGKDMCSAQLSVKEPPKFIKKLDTSKVAKQGESIQLECKISGSPEIKVVWFRNDSE
LHESWKYNMSFVNSVALLTINEASVEDTGDYICEAHNGVGHASCSTALKVKAPPVFTQKP
PPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRSSKKFKVTSKNFDTSLHIFNLEAPD
IGEYHCKATNEVGSDTCACTVKFKEPPRFVKKLSDVSTLIGDPVELQAVVEGFQPISVVW
LKDKGEVIRESENVRISFVDNIATLQLGSPEASHSGKYVCQIKNDAGMRECSALLTVLEP
ARIVEKPEPMTVTTGNPFTLECVVAGTPELSAKWLKDGRELSSGSRHHITFVRNLASLKI
PSAEMNDKGLYSFEVENSVGKSSCTVSVHVSDRVVPPSFIRKLKDTTATLGASVVLECRV
SGSAPISVGWFLDGNEIISSPKCQPSFADNVCTLTLSSLEPSDTGAYTCVAANVAGQDES
SALLTVQEPPSFEQTPDSVEVLPGMSLTFTSVFRGTPPFKVKWFKGSRELESGEACTISL
EDFVTELELLEVEPLQSGDYSCLVTNDAGSASCTTHLFVKEPATFVKRLADTSVETGSPI
VLEATYSGTPPIAVSWLKNEYPLSQSPNCGITTTERSSILEILESTIEDYAQYACLIENE
AGQDICEALVSVLEPPYFIEPLEHVEAAIGEPTTLQCKVDGTPEIRISWYKEHTKLRSAP
AYKMQFKNNVASLVINKVDHSDVGEYTCKAENSVGAVASSAVLVIKERKLPPSFARKLKD
VHETLGFPVAFECRINGSEPLQVSWYKDGQLLKDDSNLQMSFVHHVATLQILQTDQSHVG
QYNCSASNPLGTASSSAKLILSEHEVPPFFDLKPVSVDLALGESGSFKCHVTGTAPIKIT
WAKDNREIRPGGNYKMTLVENTATLTVLKVAKGDAGQYTCYASNVAGKDSCSAQLGVQEP
PRFIKKLDQSRIVKQDEYTRYECKIGGSPEIKVLWYKDEVEIQESSKFRMSFEDSVAILE
MHNLSVEDSGDYTCEARNAAGSASSSTSLKVKEPPVFRKKPFPVETLKGADVHLECELQG
TPPFQVSWYKDKRELRSGKKYKIMSENLLTSIHILNVDTADIGEYQCKATNDVGSDTCVG
SVTLKAPPQFVKKLSDVSTIIGKEVQLQTTIEGAEPISVAWFKDKGEIVRESDNIWISHS
ENVATLHFSRAEPANAGKYTCQIKNDAGVQECYATLSVLEPATIVEKPESIKVTTGDTCT
LECMVSGTPELSTKWFKDGKELTGDSKYKISFFNKVSGLKIISVAPGDSGVYSFEVQNPV
GKDSCTVSIQVSDRIIPPSFTRKLKETNGLSGSSVVMECKVFGSPPISVLWLHDGNAISS
GRKYQTTLTDNTCALTVNMLEDADAGDYTCIATNVAGSDECSAPLTVREPPSFVQKPDPM
DVLTGSNVTFTSIVKGTPPFTVSWFKGSSELVPGARCNVSLQDSVAELELFDVDTSQSGD
YTCIVSNEAGRASCTTQLFVKAPAIFVKRLNDYSIEKGKPLILEGTFSGTPPISVTWKKN
GVNVTASQRCNITTTEKSAILEILSSTVEDSGQYNCYIENASGKDSCSAQILILEPPYFV
KQLEPLKVTVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTTTCKMHFKNNVATLVFTQVD
SNDSGEYICRAENSVGEVSSSTFLTVQEQKLPPSFSRQLRDVQETVGLPVVFECAVSGSE
PISVSWYKDGKPLKDSPNVQTSFLDNIATLNIFKTDRSLAGQYSCTVTNPIGSASSSAKL
ILTEGKNPPFFDIPLAPVDAVVGESADLECHVTGTQPIKVTWAKDNREIRSGGNYQISYL
ENSAHLTIVKVDKGDSGQYTCYAINEVGKDSCTAQLNIKERLTPPSFTKKLSETIEETEG
NSFKLEGRVAGSQPITIAWYKNNVEIHPTSNCEITFKNNALLLQVKKASMADAGLYTCKA
TNDAGSALCTSSIVIREPKKPPVFDQHLTPVTASEGDFLQLSCHVQGSEPIRIQWLRAGR
EIKPSDRCSFSFASGTAVLELKDTAKADSGDYVCKASNVAGSDTSKCKVTIKEKPAAAPA
AKKAAVDGKLFFVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRILIH
QKGDESKLEIRDTTKTDSGLYRCVAFNKHGEIESNVNLQVDERKKQEKIEGDLRAMLKKT
PALKKGSGEEEEIDIMELLKNVDPKEYEKYARMYGITDFRGLLQAFELLKQSQEEETHRL
EIEELEKSERDEKEFEELVSFIQQRLTQTEPVTLIKDIENQTVLKDNDAIFEIDIKINYP
EIKLSWYKGTEKLEPSNKYEITINGDRHTLRVRNCQLKDQGNYRLVCGPHIASAKLTVIE
PAWERHLQDVTLKEGQTCTMTCQFSVPNVKSEWFRNGRVLKPQGRVKTEVEHKVHKLTIA
DVRAEDQGRYTCKHEDLETSAELRIEAEPIQFTKRIQNIVVSEHQSATFECEVSFDDAIV
TWYKGPTELTESQKYNFRNDGRCHYMTIHNVTPDDEGVYSVIARLEPRGEARSTAELYLT
TKEIPPAVAPSIPLLLPLPEEKKPPAKRIEVPEVAKKPPPPTPMIPAKPSEIIDVSSKAE
EVKITTITRKKEIHKEKEAVYERKEAVYEKKVLIEPWEEPYEELETEPYTEPYEEPYYEE
PDEDYEEIKVEAKKEVHEEWEEDYEEGQEYYEREEGYDEGEEEWEEIYHEREIIQVQKEV
HEVVKKPVVEKIEKTTRRMEEEKVQVTKVNYNCHPQHELSVIKMYIFLKVPEVQKKTVTE
EKIHVAVSKKIEPPPKVPEAPKKPVPEEKKPVPIPKKEPAAPPKVPEAPKKPAPEEKTAV
PVAKKKEAPPPKAPPKKPVPEEVVPVPIPKKAPPRAEVSKKTVVEEKKFAAEERLSMAVP
QRVELMRHEEEEWTYSEEEEQVSVSVYREEERDEEEAEITEYEVLEEPEEYVVEEKLHVI
SKRVEVEPAKVPEKHEKKIIPRPKVPAKIEEPPPTKAPEEPKKPVPERRVPAEVVEIEEP
PPTKVTEKHMKITQEEKVLVAVTKKEEPPRAREVTVTEEKKWSYTREEETVLEHREEEYE
DYEDYEEYKEYEEYEPTEEYDQYDEYAERELEHYEEAKEQEEYVVPGMAALQTTLNMLRT
HYAPEEPKKVVEEKIQISITKREKQQVTEPVAKVPGVPKKREPEEVVIFKEEVEAHEEEY
IVEEEEEYVHEEEYVHEEEYIHEEEYVHEEEYIHEEEEYLHEEEVIAEEEVLPVAPVKVP
VVPKKPVPEEKKPVPVPKKKEAPPAKVPEIPKKPEEKVSVPVPKKEKAPPAKVPEVPKKP
VPEEKAPVPVPKKVEPPPAKVPEVPKKPVPEKKVPAPTPKKVEAPPAKVPKKREVVPVPV
ALPREEEEEEAPFEEVTVPEEEILPEEEVPPEEEEVLPEEEEVLPEEEEVPPEEEEALPE
IKPKVPKPAPVPKKTVPEKKVPVPVAKKVEPPPPPKVPEIKKKVPEKKVVVPKKEEAPPT
KVPVVPKKPEPEKKVPAPALKKAVVPPAKVYEEAEEPTPEETPEEPPSIEEEEIVEEEEE
EEVPPPRAPEVVKKAVPAAPAPVPKKAEAPPTKVPEVPAKVPEKKKIPEKKVPVPKKEAV
PPAKGKAVFEEKISVAYQQEERVQERIELELVEAQVEEAFEEEQFHEVQEYFEEEEFHEV
EEFIRVEERRFQEEHKVEEVHRVIEFLEAEEVEVHEKPKIPPKKAPEVTKKMVVEEKVRV
PEEPKVPAPKVYEASEETVIEEEHVIHPQKARLKVAKGPQQQQKKHLGSLCGNNVSTDHL
TSDSDTNIFKAPEAMREMTPEMNTFEDNSAEPETPPVQVRDTYQEATVEKKTLRISRKKP
ELPPDEAPKCQNINIFKVPEAPREVVAKKKVPPPQVPEVVPVKVPEEPKEVIPEKKVSLV
PAKKPAAPPTTVPEAHEEDFPEEEVPLVLPQEPEAPPAKVPEPPKEVVPEKKVSMVPPKR
PEAPPAKVPEAPKEVVPEKKVSVAPKKKPEAPAVKGAIPGPKDDFTISFKCQRHPRKLSL
RRKCLLQLLRSLKPRLLKENTNIFKVPEVPKAAVPQKKIPEAVPPKPESPPPEAPEVPPK
EVTPEKKVPVVPPKKPEAPPPKVPETPQEAVSEEKTPKALPKKAEAAPVPVPEDQETVPE
KTRPVAPPKKPEVTPVPVPEEPKEVIPEKKVSLVPAKKPAAPPTTVPEAHEEDFPEEEVP
LVPPQEPEAPPAKVPEPPKEVVPEKKVSMVPPKRPEAPPAKVPEASKEVVPEKKVSVAPK
KKPEAPAVKGAIPGPKDDFTISFKCQRHPRKLSLRRKCLLQLLRSLKPRLLKENTNIFKV
PEVPKAAVPQKKIPEAVPPKPESPPPEGATVFKVYEEPAEEIVPEEPPEEVVEEPEPAPP
PKVTVPPKKPVPEKKAPPAVVKKPEPPPAKAPEVPKEAPPEKKVPSVVPKKPEAPPAKVP
EVPKEVVPEKKVAVPKKPEVPPAKVPEVPKKPVVEEKPVIEEKPAIPVAEKVESPPTEVY
EEPEEVAAQEEEPAPVVEEEEYEAPPPPAPVPEEPKKVVPEKKYPVIKKPEPPPPKVPEV
SKKPAPMKKVPVVKKPEPPEAEVPEAPKKITPEKRESAPVPEEPEAPPAPVEEIPEETIY
EEKATITIGRKETPPVEEREIERFIQPEEPGMEPQPEETPVQEPEPEKKVIEKPKLKPRP
PIRAPSPPKEDVKEKIFQLKAVSKKKVPEKPEVVEKVEPTPLKVPTAEKKVRKLLPEPKP
QPKEEVVLKSVLRKRPEEEEPKVEPKKVEKVKKPEEPPPPPKAVEVEAPPEPKPKERKVP
EPTKEVKTMKAPPIEPAPTPIAAPVTAPVVGKKAEAKPKDEAAKPKGPIKGVAKKTPSPI
EAERKKLRPGSGGEKPPDEAPFTYQLKAVPLKFVKEIKDIVLTEAESVGSSAIFECLVSP
STAITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAK
LIVEELPVRFVKTLEEEVTVVKGQPLYLSCELNKERDVVWRKDGKIVVEKPGRIVPGVIG
LMRALTINDADDTDAGTYTVTVENANNLECSSCVKVVEIIREWLVKPIRDQHVKPKGTAV
FTCHIAKDTPNIKWFKGYDEIPLEPNDKTEILKEGNHLILKVKNAMPEDIDEYAVEIEGK
RYPAKLTLGERDVELLKPIEDVTIYEKESASFDAEISEEDIPGEWKLKGELLRPSPTCEI
KAEGGKRFLTLHKVKLDQAGEVLYQACNAVTTAILTVKEIELDFAVPLKDVTVPEKRQAR
FECVLTREANVIWSKGPDIIKASDKFDIIADGKKHILVINDSQFDDEGVYTAEVEGKKTS
AQLFVTGIRLKFISPLEDQTVKEGQTATFVCELSHEKMHVVWFKNDVKLHTTRTVLMSSE
GKTYKLEIRETTLDDISQIKAQVKNLSSTANLKVLEADPYFTVKLHDKTGVEKDEIILKC
EVSKDVPVKWFKDGEEIVPSPKHSVKTDGLRRILKIKKAELKDKGEYTCDCGTDTTKANV
TVEARLIKVEKPLYGVEVFVGETARFEIELSEPDVHGQWKLKGEPLTASPDCEIIEDGKK
HVLVLYNCQLDMTGEVSFQAANAKSAANLKVKELPLIFITPLSDVKVFEKDEAKFECEVS
REPKTFRWLKGTQEIAGDDRFELIKDGTRHSLVIKSAAFEDEAKYMFEAEDKRTSGKLII
EGIRLKFLTPLKDVTAKERENAVFTVELSHDNIPVSWFKNDQRLHTSKRVSMHDEGKTHS
ITFKDLSIDDTSQIRVEAMGISSEAKLTVLEGDPYFTGKLQDYTGVEKDEVVLQCEISKA
DAPVKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTCDCGTDQTSGKLDIED
REIKLVRPLYSVEVMETETARFETEISEDDIHANWKLKGEALLQTPECEIKEEGKIHVLI
LHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVTAGETATFDCELSYEDI
PVEWYLKGKKLEPNDKVVTRSEGRVHTLTLRDVKLEDAGEVQLTAKDFKTQANLFVKEPP
VEFTKPLEDQTVEEEATAVLECEVSRENAKVKWFKNGTEILKSKKYEIVADGRVRKLIIH
GCTPEDIKTYTCDAKDFKTSCNLNVIPPHVEFLRPLTDLQVKEKETARFECEISKENVKV
QWFKDGAEIKKGKKYDIISKGAVRILVINKCLLNDEAEYSCEVRTARTSGMLTVLEEEAV
FTKNLANLEVSEGDTIKLVCEVSKPGAEVTWYKGDEEVIETGRFEILTDGRKRILIIQNA
QLEDAGSYNCRLPSSRTDGKVKVHELAAEFISKPQNLEILEGEKAEFVCTISKESFEVQW
KRDDQTLESGDKYDIIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAHLTVIEKLRIVV
PLKDTKVKEQQEAVFNCEVNTEGAKAKWFRNDEAIFDSSKYIILQKDLVYTLRIRDARLD
DQANFSVSLTNHRGENVKSAANLIVEEEDLRIIEPLKDIETMEKKSVTFWCKVNRLNVTL
KWTKNGEEVAFDNRISYRIDKYKHSLIIKDCGFPDEGEYIVTAGQDKSVAELLIIEAPTE
FVEHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDC
RLEDECEYACGVEDRKSRARLFVEEIPVEIIRPPQDILEAPGADVIFLAELNKDKVEVQW
LRNNMIVVQGDKHQMMTPPKIKTSDQDLVVDAGQPLTMVVPYDAYPKAEAEWFKENEPLS
TKTVDTTAEQTSFRILEAKKEDKGRYKIVLQNKHGKAEGFINLQVIDVPGPVRNLEVTET
FDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKTWVLVTDRADSCEFTVTGLQKGGVEYL
FRVSARNRVGTGEPVETDSPVEARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAE
ITNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATP
FVKVADPIERPSPPVNLSASEQTQSSVQLTWEPPLKDGGSPILGYIIERQEEGKDNWIRC
NMKPVPELTYKVTGLQKGNKYLYRVSAENAAGVSDPSEILGPLTADDASVEPTMDLSAFK
DGLEVIVPNPIKILVPSTGYPRPKATWTFGDQVLEAGDRVKIKTISAYAELIISPSERPD
KGIYTLTLENPVKSISGEIDVNVIARPSAPKELKFSDVTKDSVHLTWEPPDDDGGSPLTG
YVVEKRDMSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYTDEPVNM
SAPATVPDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVEKCPRGSDKWVACGEPV
PDTKMEVTGLEEGKWYAYRVKALNRQGASKPSKPTEEIQAVDTQEAPEIFLDVKLLAGLT
VKAGTKIELPATVTGKPEPKITWTKADTLLRPDQRITIENVPKKSTVTITDSKRSDTGTY
IIEAVNVCGRATAVVEVNVLDKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVE
RKATDSDVWHKLSSTVKDTNFKATKLTPNKEYIFRVAAENMYGVGEPVQATPIIAKYQFD
PPGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDTT
YRVKGLTNKKKYRFRVLAENLAGPGKPNPPWPPGKPTVKDIGKTSLVLNWTKPEHDGGAK
IESYVIEMLKTGTDDWVRVAEGVPTTEHLLTGLMEGQEYSFRVRAVNKAGESEPSEPSDP
VLCREKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVD
TTVKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYTEIGDSVLAKDTFTTPGPPYALTVVD
VTKRHVDLKWEPPKNDGGRPIQRYIIEKKEKLGTRWVKAGKTSGPDCNFRVTDVIEGTQQ
VXVLKFGQKTKQELVTQVSPQKFCQLKILLVSHTDYSKKLSKGLMMRLWYQCITVFPGPP
SPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFK
VEEGVVPDKEYVLRVRAVNAVGVSDPSEISENVVAKDPDCKPTIDLETHDIVVIEGEKLS
IPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVHADAGVYTITLENKL
GSATASINVKVIGLPGPCKDIKASDITKSSCKLTWEPPEFDGGSPILHYVLERREAGRRT
YIPVMSGENKLSWTVKDLIPNGEYFFRVKAVNKIGGGEYIELKNPVIAQDPKQPPDPPVD
VEVHNPTAKAMTITWKPPLYDGGSKIMGYIIEKLAKGEDRWKRCNEHLVPVLTYTAKGLE
EGKEYQFRVRAENAAGIGEPSRATPPTKAVDPIDAPKVILRTSLEVKRGDEIALDATISG
SPYPTITWIKDENVIVPEEIKKRVAPPVRRKKGEAEEEEPFTLPLTERLSINNSKQGESQ
LRVRDSLRPDHGQYMIKVENDHGVAKAPCTVSVLDTPGPPINFVFEDIRKDSVLCKWEPP
LDDGGSEIINYTLEKKDKTKPDSEWIVITSTLRNCKYSVTKLIEGKEYLFRVRAENRFGP
GPPCVSKPLLAKDPFEPPDAPDKPIVDDVTSNSMVVKWNEPKDNGSPILGYWLEKREVNS
THWSRVNKALLSSLKTKVDGLLEGLTYVFRVCAENAAGPGKFSPPSDPKTARDPISPPGP
PVPRVADTSSTTIELEWEPPAFNGGGEIMGYFVDKQLVGTNEWSRCTEKMVKVRQFTVKE
IREGADYKLRVSAVNAAGEGPPGETEPVTVAEPQEPPTVELDVSVKGGIQIMAGKTLRIP
AVVTGRPVPTKVWTIEEGELDKERVVIENVGTKSELIIKNALRKDHGRYVITATNSCGSK
FAAARVEVFDVPGPVLDLKPVVTNRKMCLLNWSDPADDGGSEITGFIIERKDAKMHTWRQ
PIETERSKCDITGLIEGQEYKFRVIAKNKFGCGPPVEIGPILAVDPLGPPTSPERLTYTE
RTKSTITLDWKEPRSDGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVDNLDEHQMY
EFRVKAVNDIGESEPSLPLNVVIQDDEVPPTIKLRLAVRGDTIKVKAGEPVNIPADVTGL
PMPKIEWSKNEKVIEKPTDALNITKEEVSRSEAKTELSIPKAVREDKGTYTITASNRLGS
VFRNVHVEVYDRPSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYIIDKRDASRKKSE
WEEVTNTAVERRYGIWKLIPNGQYEFRVRAVNKYGTSDECKSDKVVIQDPYRLPGPPGKP
KVLERTKGSMLVSWTPPLDNGGSPITGYWLEKREEGGAYWSRVSRAPITKVGLKGVEFSV
PRLIEGVKYQFRAMAINAAGIGPPSEPSDPAVAGDPIYPPGPPSCPEVKDKTKSSISLAW
KPPAKDGGSPIKGYIVEMQEEGTTDWKKVNEPDKLLTACECVVPNLKELRKYRFRVKAVN
EAGESEPSDTTGEIPATDIQEVPEVFIDIGAQDCLICKAGSQIRIPAVIKGRPTPKSSWE
FDGKAKKAMKDGIHDIPEDAQLETAENSSVIVIPECTRAHSGKYSITAKNKAGQKTANCR
VKVMDAPGPPKDLKVSDITRGSCRLSWKMPDDDGGDRIKGYVIEKKTIDGKAWTKVNPNC
GSTAFVVPDLISEQQYFFRVRAENRFGIGPPAETIQRTTARDPIYPPDLPIKLKIGLITK
NTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGKKKEAWRQCNRRDVEELEFTVEDLVEGG
EYEFRVKAVNEAGVSKPSATVGPVTVKDQTCPPSIELKEFMEVEEGTDVNIVAKIKGVPF
PTLTWFKAPPKKPDSKEPVVYDTHVNKQVVDDTCTLVIPQSRRSDTGLYSITAVNNLGTA
SKEMRLNVLGRPGPPVGPIKFESISADQMTLSWLPPKDDGGSKITNYVIEKREANRKTWV
RVSSEPKECMYTIPKLLEGHEYVFRIMAQNKYGIGEPLDSEPETARNLFSVPGAPDKPTV
SSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTGL
IEGSDYQFRVYAINAAGVGPASLPSDPVTARDPVAPPGPPFPKVTDWTKSSVDLEWSPPL
KDGGSKITGYIVEYKEEGKEEWEKGKDKEVRGTKLVVTGLKEGAFYKFRVRAVNIAGVGE
PGEVTDIIEMKDRIVSPDLQLDASVRDRIVVHAGGVIRIIAYVSGKPPPTVTWNMNERAL
PQEATIETTAISSSMVIKNCQRSHQGVYSLLAKNEGGERKKTIIVDVLDVPGPVGIPFLS
DNLTNDSCKLTWFSPEDDGGSPITNYVIQKREADRRAWTPVTYTVTRQNATVQGLIQGKS
YFFRIAAENSIGMGPFVETPNALVIRDPITVPERPEDLEVKEVTKNTVTLTWNPPKYDGG
SEIINYVLESRLIGTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFC
TKPITCKDELAPPTLDLDFRDKLTVRVGEAFALTGRYSGKPKPKVDWFKDEADVLEDDRT
HIKTTPTTLALEKTKAKRSDSGRYCVVVENSTGSRKGFCQVNVVDRPGPPVGPVVFDEVT
KEYMVISWKPPLDDGGSEITNYIIEKKELGKDIWMPVTSASAKTTCKVPKLLEGKDYIFR
IHAENLYGISDPLVSDSMKARDRFRVPDAPEQPVVTEVTKDSALVTWNKPNDGGKPITNY
ILEKRETMSKRWVRVTKEPIHPYTKYRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVF
ARDPIAKPSPPINPEAIDTTCNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHT
PESCPETKYKVTGLRDGQTYKFRVLAVNEAGESDPAHVPEPVLVKDRLEPPELILDANMA
REQHIKVGDTLRLSAIIKGVPFPKVTWKKEDREAPTKAQIDVTPVGSKLEIRNAAHEDGG
IYSLTVENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVVTNYV
VERKDVATAQWSPLSTTSKKKSHMAKHLNEGNQYLFRVAAENQYGRGPFVETPKPIKALD
PLHPPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGAKDWIKFKTVKNL
ECVVTGLQQGKTYRFRVKAENIIGLGLPDTTIPIECQEKLEPPSVELDVKLIEGLVVKAG
TTVRFPAIIRGVPVPTAKWATDGTEITTDDHYTVETDSFSSVLTIKNCLRKDTGEYQLTV
SNAAGTKTVAVHLTVLDVPGPPTGPINILDVTPEYMTISWQPPKDDGGSPVINYIVEKQD
TRKGTWGVVSAGSSKLKLKVPHLQKGCEYVFRVKAENKMGVGPPLDSIPTVAKHKFSPPS
PPGKPVVTDITENAATVSWTLPKSDGGSPITGYYVERREITGKWVRVNKTPIADLKFRVT
GLYEGNTYEFRVFAENLAGLSNPSPSSDPIKACRPIKPPGPPINPKLKDKTKESADLVWT
KPLSDGGSPILGYVVECQKPGTTQWDRINKDELIRQCAFRVPGLIEGNEYRFRIRAANIV
GEGEPRELAESVIAKDILHPPEVELDVTCRDVITVRVGQTIRILARVKGRPEPDITWSKE
GKVLVKDKRVDLIHDLPRVELQIKEAVRADHGKYIISAKNSSGHAQGSAIVNVLDRPGPC
QNLKVSNVTKENCTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVASDVTKRLIKANLL
ANNEYYFRVCAENKVGVGPTIETKTPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPD
YDGGSPNLSYHVERRLKGSADWERVHKGSIKETHYMVDKCVENQIYEFRVQTKNEGGESD
WVRTEEVVVKEDLQKPVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLT
RSPRVKIDTSAESSKFSLTKAKRSDGGKYVVTATNPAGSFVAYATVNVLDKPGPVRNLKI
ADVSSDRCTIRWDPPEDDGGCEIQNYILEKCESKRMVWSTYSANVLTPGATVTRLIEGNE
YIFRVRAENKIGTGPPTESKPVIAKTKYDRPGRPDPPEVTKVSKEEMTVVWNAPEYDGGK
SITGYYLEKKEKHAVRWVPVNKSAIPERRLKVQNLLPGHEYQFRVKAENEVGIGEPSLPS
RPVVAKDPIEPPGPPTNFKVVDTTKNSITLAWGKPVYDGGAPIIGYVVEMRPKIADASPD
EGWKRCNAAAQLVRMEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEAIRPKEILEPPE
IDLDASMRKLVVVRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKGQVDLVDTMAFLVI
PNSTRDDSGKYSLTLVNPAGEKAVFVNVKVLDTPGPVSDLKVSDVTKTSCHVSWAPPEND
GGSPVTHYIVEKREAERKTWSTVTPEVKKTSFNVTNLVPGNEYFFRVTAVNEYGPGVPTD
VPKPVLASDPLSEPDPPRKVEVTEMTKNSATLAWLPPLRDGGAKIDGYIISYREEDQPAD
RWTEYSVVKDLSLIITGLKEGKKYKFRVAARNAVGVSMPREAEGVYEAKEQLLPPKILMP
EQITIKAGKKLRVEAHVYGKPNPICKWKKGEDDVVTSSHLAIHKADSSSVLIIKDVTRKD
SGYYSLTAENSSGTDTQKIKVTVMGLEYSFRIYALNKAGSSPPSKPTEYVTARMPVDPPG
KPEVVDVTKNSASLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTTPHQIPLEEYTAT
GLEENAQYQFRAIAKTAVNISQPSEPSDPVTILAENVPPRIELSVEMKSLLTVKAGTNVC
LDATVFGKPMPTVSWKKDSTPIKQTEGVKMAMKRNLCTLELFSVNRKDSGDYTITAENSS
GSKSATIKLKVLDKPGPPASVKINKMYADRAMLSWEPPLEDGGSEITNYIVDKRETSRPN
WAQVSATVPITSCTVEKLIEGHEYQFRICAENKYGVGDPIFTEPVIAKNPYDPPGRCDPP
VISNITKDHMTVSWKAPADDGGSPITGYLVEKRETQAVNWTKVNRKPVIERTLKATGLQE
GTEYEFRVTAINKAGPGKPSDASKAVYAQDPLYPPGPPAFPKVYDTTRSSVSLSWGKPAF
DGGSPIIGYLVEVKRADSDHWVRCNLPEKLQKTRFEVTGLMENTEYQFRVYAVNKIGYSD
PSDVPDKHCPKDILIPPEGELDAELRKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNL
RERIGLDIKSTDFDTFLRCENVNKYDAGKYILTLENSCGKKEYTIVVKVLDTPGPPVNVT
VKEISKDSAYITWDPPIIDGGSPIINYVVEKRDAERKSWSTVTTECPKTSFRVSNLEEGK
SYFFRVFAENEYGIGDPGETRDAVKASETPGPVVDLKVLAVTKSSCTIGWKKPRSDGGSR
ITGYVVDFLTEENKWQRVMKSLSLQYSTKDLKEGKEYTFRVSAENENGEGTPSEIMVVAK
DDVVAPDLDLKDLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVEST
AVNTTLVVYDCQKSDAGKYTITLKNVAGTKEGTLSIKVVGKPGIPTGPIKFDEVTAEAMT
LKWGPPKDDGGSEITNYVLEKRDSVNNKWVTCASAVQKTTFRVTRLHEGIEYTFRVSAEN
KYGVGEGLKSEPIVAKHPFDVPDAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHIEF
KERNSLLWKRANKTPIRMKDFKVTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPI
DPPGKPEVISVTRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPDCAFT
VTDLVEGGKYEFRIRAKNTAGAISAPSESTGTIICKDEYEAPTIVLDPTIKDGLTVKAGD
SIVLSAISILGKPLPKSSWSKAGKDIRPSDIAQITSTPTSSMLTVKYATRKDAGEYTITA
TNPFGTKEEHVKVSVLDVPGPPGPIEISNVSAEKATLTWTPPLEDGGSPIKAYVLEKRET
SRLLWTVVSEDIQACRHVVTKLIQGNEYLFRVSAVNHYGKGEPVQSEPVKMVDRFGPPGP
PGKPEISNVTKNTATVSWKRPIDDGGSEITGYHVERREKKGLRWVRATKTPVSDLRCKVT
GLQEGNTYEFRVSAENRAGIGPPSDASNPVLMKDVAYPPGPPSNAHVTDTTKKSASLAWG
KPHYDGGLEITGYVVEHQKVGDDAWIKDTTGTALRITQFVVPDLQTKEKYNFRISAVNDA
GVGEPAVIPNVEIVEKETAPDFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDN
INLKHRANIENTESFTLLIIPECNRYDTGKFVMTIENPAGKKSGFVNVRVLDTPGPVLNL
RPTDITKDSVTLHWDLPLIDGGSRITNYIVEKREATRKSYSTVTTKCHKCTYKVTGLTEG
CEYFFRVMAENEYGIGEPTETTEPVRASEAPLPPDSLNIMDITKNTVSLAWPKPRHDGGS
KITGYVIEAQRKGSDQWTHISTVKGLECVVRNLTEGEEYTFQVMAVNSAGRSAPRESRPV
IVKEQTMLPELDLRGIYQKLVIARAGDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNV
ENTATSTILNINECVRSDSGAYPLTAKNTVGEVGDVITIQVHDIPGPPTGPIKFDEVSSD
FVTFSWEPPENDGGVPISNYVVEMRQTDSTTWVELATTVIRTTYKATRLTTGVEYQFRVK
AQNRYGVGPGITSASVVANYPFKVPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYH
IERKERNGILWQTVSKALVPGNIFKSTGLTDGIAYEFRVIAENMAGKSKPSKPSEPTFAL
DPIDPPGKPVPLNITRHTVALKWAKPEYTGGFKITSYVVEKRDLPNGRWLKANFSNILEN
EFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDLEAPRIMVDVKFKDTITLK
AGEAFKLEADVSGRPPPTMEWAKDGKELEGTGKLEIKIADFSTHLINKDSSRTDSGAYIL
TATNPGGFAKHIFNVKVLDRPGPPEGPLAVSDVTSEKCVLSWLPPLDDGGAKIDHYIVQK
RETSRLAWTNVATEVQVTKLKVTKLLKGNEYIFRVMAVNKYGVGEPLESEPVLAVDPYGP
PDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQRWVKCNKKALTDLRF
KVSGLTEGHEYEFRIMAENAAGVSAPSATSPFYKACDSVFKPGPPGNPRVLDTSRSSISI
AWNKPIYDGGSEITGYMVEIALPEEDEWQVVTPPAGLKATSYTITNLIENQEYKIRIYAM
NSEGLGEPALVPGTPKAEERMLPPEIELDADLRKVVTIRACCTLRLFVPIKGRPAPEVKW
AREHGESLDKASIESTSSYTLLVVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGP
PQNLKIKEVTKTSVTLTWEPPLLDGGSKIKNYIVEKRESTRKAYSTVATNCHKTSWKIDQ
LQEGCSYYFRVLAENEYGIGLPAETAESVKASERPLPPGKITLMDVTRNSVSLSWEKPEH
DGGSRILGYIVEMQSKGSDKWATCATVKVTEATITGLIQGEEYSFRVSAQNEKGISDPRQ
LSVPVIAKDLVIPPAFKLLFNTFTVLAGEDLKIDVPFIGRPTPTVTWHKDDVPLKQTTRV
NAESTENNSLLTIKEACREDVGHYTVKLTNSAGEATETLNVIVLDKPGPPTGPVKMDEVT
ADSVTLSWEPPKYDGGSSINNYIVEKRDTSTTAWQIVSATVARTTIKASRLKTGCEYQFR
IAAENRYGKSTYLNSEPVIAQYPFKVPGPPGTPFVTLASKDSMEVQWHEPVSDGGSRVIG
YHLERKERNSILWVKLNKTPIPQTKFKTTGLEEGIEYEFRVSAENIVGIGKPSKPSECYA
AHDPCDPPGRPEAIIVTRNSVTLQWKKPTYDGGSKITGYVVEKKELPDGRWMKASFTNII
DTQFEVTGLIEDHRYEFRVIARNAAGVFSEPSESTGAITARDEVEPPRISMDPKYKDTVV
VQAGESFKIDADIYGKPIPTTQWVKGDQELSSTARLEIKTTDFATSLSVKDAVRVDSGNY
ILKAKNVAGEKSVTVNVKVLDRPGPPEGPVAISGVTAEKCMLAWKPPLQDGGSDIINYIV
ERRETSRLVWTLVDANVQTLSCKVTKLLEGNEYIFRIMAVNKYGVGEPLESEPLIAKNPF
VVPDAPKAPEVTAVTKDSMIVVWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGEL
RLRVTGLLENHNYEFRVSAENAAGLSEPSPPSAYQKACDPIYKPGPPNNPKVMDVTRSSV
FLSWTKPIYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTNLEVEKLLEKHEYNFRIC
AINKAGVGEHADVPGPVMVEEKLEAPDIDLDLELRKVINIRAGGSLRLFVPIKGRPTPEV
KWGKVDGEIRDAAIIDVTSSFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFVTVRVLDTP
SPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVTNCHKNSWKI
DQLQEGCSYYFRVTAENEYGIGLPARTADPIKVAEVPQPPGKITVDDVTRNSVSLSWTKP
EHDGGSKIIQYIVEMQAKNTDKWSECARIIAVNETGRGVTPDRVACVQIIGLLRISVIIG
SGVRDGGDERVIFQLRLDQRVYSLVCLAEHPTPRALTPLTVDAFAIYAYHGMSVLLGALN
SYISYDICTVYEYDRDQ
NT seq 72054 nt NT seq  +upstreamnt  +downstreamnt
atgactactcaagcaccgacgtttacgcagccgttacaaagtgttgtggtactggagggt
agtgccgcaacctttgaggctcacattagtggttccccagttcctgaggtgagctggttt
cgggatggccaggtgatttcaacttccactctgcccggcgtgcagatctcctttagcgat
ggccgcgctagattgatgatccccgccgtgactaaagccaacagtggacgatactccctg
agagccaccaatggatctggacaagcgactagtactgctgagcttcttgtgacagccgag
accgcaccacccaacttcagtcaacggctgcagagcatgactgtgagacaaggaagccaa
gcgcgactccaagtgagagtgactggaatccctacacctgtggtgaagttctaccgggat
ggagccgaaatccagagctcccttgatttccaaatttctcaagaaggcgacctctacagc
ttactgattgcagaagcataccctgaagactccgggacctattctgtaaacgccaccaac
agcgtcgggagagctacttccactgcggacctgctggtccaaggtgaagaagtagtgccc
gctaaaaagacaaagacaattgtttcaacggctcagatttcagaaaccagacaaacccgg
acagaaaagaagattgaagcccactttgatgccagatcaattgcaacagttgagatggtc
atagatggcgccactggacagctgccgcataaaacacctcccaggatacctcccaagccc
aaatccaggtctccaacaccaccttccattgccgccaaagcacagctggcccggcaacag
tccccatcacccataagacactccccctccccggtcagacacgtgcgggcaccgacccca
tctccagtcaggtctgtgtctccagcagggaggatctccacttcccccatcagatctgtt
aagtcaccactgctcatccgcaagactcagaccaccaccgtggccacaggccccgaggtg
cctcccccttggaagcaagagggctacgtggcctcctccaccgaggctgagatgagagag
acgacgatgacaagctctacccagatcagaagagaagagaggtgggaagggagatacggt
gtccaggagcaagtgaccatcagtggagctgcgggcactgcggccagtgtgtcagccagg
tcgtcattcacggcagaagccgtcactactggggctaaggaggtgaaacaggagacagac
aagagcgcagctgtcgcgactgtcgttgctgctgttgatatggccagagtgagagaacca
gttatcagtgctgtagaacaaactgctcagaggacaaccacgactgctgtgcacgtacaa
cctgctcaaaaacagatgagaaaagaggcggagaagaccgcagtaaccaaggtcgtagtt
gctgcagataaagccaaggaacaggaactaagattacgaaccagagaagagattatcaca
aagcaagagcagacgcacattgctcatgagcagataagaaaagaaaccgaaaaagcattt
gtgccaaaggtagtgatctccgcaaccaaagccaaagaacaagaaactagaatcactgga
gaaattactactaaacaagaacaaaaacgaataactcaagaaacactaaggcaggaaact
gagacaattgctgcatccgtggtggttgccaccgccaagtccacaaagctagaggcagct
gtgggaattcaagaggaaactgccatacaacaggatcaaacgcacctcactcatggacag
gtgggcgttgggaaaaaggcagaagccgtggcaaccgttgtagctgctgtggaccaggcc
cgcgtgagagaacccagagagcccaggcacgtggaggaatcctattctcagcagaccact
ttagagtatggctacaaagaacacatttccgccacaaaggtgcctgagcagccccagcgc
ccagcctcagagccccacgttgtccctaaagcagtcaagcctgttgtgattcaggctcct
tctgagactcatatcaaagctactgaccaagtgggaatgcatatatcatcacaggcatcg
atagctggtagtgctatcgccacattacaaaaggagttgtcaaccacgtcttctactcag
aagatcaccaaatcagtgaaggcacccaccgtgaagcccggagagactagagtaagggca
gagcccactccttccccaaagttcccctttgctgacgtgccggcgccagatacttacaag
agtcaagctggcattgaggtgaagaaggaggtcggggtgagcatcagtggcagcactgtt
cgtgaggagcagtttgaattactgcgtggacgtgaagccaaggtaacagagacagcaaga
gtgcctgctcctgccgaagtccccgtcactccacctaccttagtctcgggcttgaaaaat
gtgactgtcgtagaaggcgaatctgtcaccttggagtgccacatctctggatacccatcc
cccaaagtgacatggtacagagaagactaccaaatcgagagttccatcgatttccagata
accttccagagtggaattgctcgtctcatgatccgcgaagcctttgcagaagacagcgga
cggttcacgtgcagtgctgtgaatgaggctgggaccgtcagcacttcctgttatcttgct
gtgcaagtgtcagaagagtttgacaaggaaacaactctgactgagaaatttaccacagaa
gagaaacgcttcgtggagtcaagagatgtagtaatgactgacaccagcatcacagaggag
caggcagggcctggagagcctgccgcacctttcttcatttcaaagccggtggtccagaaa
ctggtggaaggtgggagtgttgtgtttgaatgccagatcggtggcaacccaaaaccccac
gtctactggaaaaaatctggtgttcctcttaccactggatacagatacaaagtgagctat
aacaagcaaactggggagtgcagactggtgatctctatgacgttcgctgatgatgctgga
gaatatactattgtcatccgaaataagcatggggagacttccgcgtctgcctccttactc
gaggaagatgcagggaccctgcccccggatgccttgcaggtccaggcagctagcgtgctg
ggcacggaggatagtggcagactggagaatgtgctccttgcctccggagagcaaaggcac
ctcacttcccgattagtgttgcctgccgattatgaggcattgataaagtcccagcaagaa
acgctttaccagacacaaatgagcacgtttattcaagaacccaaagtgggagaaatagcg
cctggatttgcatattctgaatatgaaaaggagtatgaaaaggaacaggccctaattagg
aagaaaatggccaaagatactgtgatggtcaggacttttgttgaagaccaagaattccat
atctcttcgtttgaagagaggcttattaaagaaattgaatatagaattataaagacgact
ctggaggagcttcttgaggaggatggagaagaaaggatggccgttgacatttctgaatct
gaagctgtcgaatcaggattcgatataagaataaaaaactatagaattcttgaggggatg
ggagtcacttttcattgcaagatgtctggatatccgttacccaagattgcgtggtataaa
gacggcaagcgcatcagacgcggggagagatatcaaatggactttctgcaggatggcaga
gccagcctgcgcatacccgttgtccttccagaggacgagggcatctataccgcgtttgcc
agcaatatcaaaggaaatgcaatttgctcagggaaactctatgtggagcctgctgcaccg
tttagtgctccaacttacatgcccaccccagaggcagtgagcagaatcaggtctgtctct
ccacgttcagtgagcaggtcacctatccgcatatctcctgcgatgtcccctgcacggatg
tcccctgcaagaatgtcccccgcacggatgtcccctgcacggatgtcccctggacgcagg
ctggaggaaacagatgaatctcaactggagagactctataagccagtctttgtattaaaa
cctgcttctttcaaatgtttagaaggacagactgccagatttgacttaaaggttgtgggg
agacccatgccagagacgttctggtttcacaatggacagcaaattgtcaatgattataca
cataaagtcgtcattaaagaagatggaactcagtcactgatcattgtccctgcgttgccc
agtgactcaggagaatggaccgtagtggcccaaaacagagcaggaaaatccacaatatct
gtgactttaactgtggaagctgtggagcaccagatcaagccagcatttgtggaaaaactg
aaaaatgtcaacataaaggaaggttccaggcttgaaatgaaagtcagagctacaggcaac
cccaatcctgacattgtgtggctgaaaaacagtgacatcattgtacctcataaataccca
aggatcaggattgaaggaaccaaaggagaagccgctcttaagatcgattccaccatcagc
caggattctgcctggtacactgccacagctattaacaaggcgggccgggacaccacaagg
tgcaaagtcaacattgaggttgagtttgcagaacctgaaccagaacgaagactgattatc
ccacgaggaacctacagagcaaaggagatcagtgccccagaactggagcctctccatctg
agatacggtcaagagcagtgggaggagggcgacctctatgacaaggagaaacaacagaag
ccatttttcaagaaaaaactcacttccctcagactgaagcgctttggacctgcccacttt
gagtgcagactgacaccaattggcgacccaaccatggtggtcgagtggctccacgacgga
aagccactggaggcagccaacaggctccgtctgattaatgaattcgggtactgcagcctt
gattatgaagctgcgtattccagagacagcggcgtcatcacctgcagggccactaacaaa
tacgggacagatcacacctctgctactcttattgtaaaagatgagaaaagtctagtggag
gagtctcagttgcctgaggggaagaaaggcttacagagaatagaagaactggagaggatg
gcgcacgaaggtgcacttacaggtgtaacaacagatcaaaaggaaaagcaaaagccagac
attgtcctgttcccagagccggtgagagtgcttgaaggggagacagccagattccgatgc
cgagtgacaggctaccctcagcccaaggtcaactggtacctcaacggacagctcatccgg
aaaagcaaacggttcagagtccgctacgacggcattcattacctggatattgtggactgc
aaatcctatgatacaggcgaagtcaaggtcactgcagaaaatcctgaaggcgtcacagaa
cataaagtaaaactcgaaatccagcagagggaggatttcagatctgtcctcaggcgtgct
cccgagccaaagcctgagttccatgtacacgagccaggaaagcttcagttcgaagtacag
aaggtagacagacccgttgacaccggcgaaaccaaagaggtggtgaagctgaaaagggct
gagaggattacccacgagaaggtgtccgaggagtctgaggagctccgcagtaaattcaag
cgccggacggaagaggggtactatgaggctatcacagccgtggagctgaagtctcgcaag
aaggatgagtcttatgaggagctcctcaagaaaactaaagatgagctgctgcactggacc
aaagagttaacagaagaggagaagaaggccttggctgaagagggcaaagtcaccattcca
acctttaaacccgagagaattgaactcagccctagtatggaggcacccaaaatcttcgaa
cgaatccaaagccagacagttggccagggatctgatgctcactttagagtcagagttgtg
gggaaaccagaccctgaatgtgaatggtataaaaatggtgtaaaaatcgagcgatctgac
cgaatctactggtactggccagaagacaatgtttgtgaactggtcataagagatgtgact
gcggaagactcggccagcatcatggtaaaggccatcaacatagctggggaaacctcgagt
catgcattcctacttgtccaagccaagcaattgatcactttcacacaagaattgcaagat
gttgttgctaaggaaaaggacaccatggcaacatttgaatgtgaaacttcagaaccattt
gtcaaagtaaaatggtataaagatggtatcgaagttcatgcaggagataagtacaggatg
cactcggaccgaaaagttcacttcctgtctgtgctgaccattgacacatctgatgctgaa
gactacagctgtgtacttgtggaagatgaaaacatcaaaacaacagcgaaacttattgtg
gaaggtgctgtagttgaattcgtgaaagaacttcaggacatagaagtcccagagtcatac
tcaggagagttagagtgtattatatccccagaaaacatagaaggtaaatggtatcacaat
gatgtggagttaaagtccaatggcaaatactcaattacatcccgccgtgggcgccagaac
ctcacagtcaaggatgtaaccaaagaggaccagggagagtactgctttgttgttgatggg
aaaaagacaacctgtaaactgaagatgaaaccccgacctattgctattctccaaggactt
agtgatcaaaaggtctgcgagggtgacattgttcaacttgaagtcaaagtctccttagaa
aatgtagaaggcgtctggatgaaagatggccaagaagtacagcacagtgacagagttcac
attgtaatagacaagcagtcccacatgctgcttattgaagacatgaccaaagaggatgct
gggaattactcctttactatccctgcccttggactctctaccagtgggaatgtctctgtc
tatagtgttgacgtgataacacctctcaaagatgtcaatgtgattgaaggtaccaaggct
gtacttgaatgcaaggtctcggttccagatgtaacgtctgttaaatggtacctaaacgac
gaacaaatcaagcctgatgatcgtgtacagtccattgtcaaaggcaccaaacagcgactt
gtgattaaccgaactcatgcttctgatgaagggccttacaaactgatggttggcagggtt
gaaaccagctgtaatctctctgtagagaaaattaaaatcatcagaggtctccgtgacctg
acgtgcacagaaactcaaaatgtggtctttgaggttgagctgtcccactcaggaattgat
gttgtatggaattttaagggccaggaaattaagcccagttctaaatataaaattgaagct
catgggaaaatatacaaactgacagtcctgaatatgatgaaggatgacgaaggagaatat
gcattttatgctggagaaaatacaacatctggaaaacttaccgtggcaggaggggccatc
tccaaaccactcacagaccagactgtggctgaatcccaggaagctgtgtttgaatgtgaa
gtggccaaccctgagtctgagggagaatggctgaaagacggaaaacacttgactctgagt
aacaacttcagaagtgaatccgatggccacaaaaggaggcttgtcatcgctgccgccaag
ttagatgacattggagaatacacctacaaggttgcaacctccaaaacgtctgccaagctg
aaagttgaagctgtcaaaattaagaagactctgaggaacctcacagtgacagagacacag
gacgccatcttctctgttgaactcacacacccagatgtcaaaggggtccagtggatcaaa
aatggagttgtcttagattccaatgacaagtatgagatctcggtcaaagggacactttat
tctctgaagattaaaaactgtgccatggcagatgaatctgtgtatggcttcaaactggga
aggctaggagccagcgccagactgcacgttgagactgtcaagattattaaaaaaccaaag
gatgtgactgccttggagaacgccaccgttgccttcgaagtcagtgtttcccatgacacg
gttccagtaaaatggttccacaagaatgtggagattaagcctagcgacaagcacagactg
gtttccgagagaaaggttcacaagctgatgctccagaacatctccccctcggatgctggg
gagtacacagccgtggtggggcagctggagtgcaaagctaagctgtttgtggagacactg
catatcacgaagactatgagaaatattgaggttcctgaaaccaaagcagcctctttcgag
tgtgaggtgtcccacttcaatgtcccttccatgtggctgaagaacggtgtggagatcgag
atgagcgaaaagttcaagatagtggtgcaggggaaactccaccagctgatcatcatgaac
accagcactgaggactcagcagaatacacattcgtttgtggcaatgaccaagtcagtgct
accctgacagtgaccccgatcatgattacatccatgctgaaagacatcaatgctgaagaa
aaggacaccataactttcgaggtgacagttaactatgaaggcatctcttacaaatggtta
aagaatggtgtggagatcaagtcgactgacaggtgccagatgagaaccaagaagctgaca
cactctctgaacatcaggaatgtccacttcggagatgctgcggattacacttttgtggct
gggaaagccacatcgacggccaccctttatgtggaagctcgtcatatagaatttaggaaa
cacattaaggacattaaggttctagagaagaaacgagccatgtttgaatgtgaagtttct
gagcctgacatcactgtccagtggatgaaagatggccaagagcttcagatagtggacaga
ataaagattcagaaggagaaatatgtccaccgccttctgattccatcggcacgcatgtct
gacgctggaaaatacacagtggtggcgggaggcaacatgtcaactgctaacctctttgta
gaaggcagggatgtccgcatccggagcattaaaaaggaagtccaggtcattgagaagcag
cgtgctgttgtggagttcgaagtcaatgaagatgacgttgatgcccactggtacaaagac
ggcatcgaaatcaatttccaagttgaagaacgacaccaatatgtggtggagagaagaatt
caccggatgtttatatctgaagcgaggcacagtgacgcaggcgaatacacctttgtggcc
ggcagaaacaggagctccgtgactctctatgtcaatgctccagagcctccccaagtcctg
caggaacttcagcctgtcaccgtacagtctggcaagccagctcgcttctgcgctgtgata
gcaggcagaccacagcccaagatttcctggtacaaggaagagcagctgctttccacgggc
ttcaagtgcaaatttctccacgatgggcaggagtacacgcttttgctcattgaggccttc
ccagaggatgcagctgtctatacttgtgaagccaagaacgactatggagtagccacaaca
tcagcttctctttctgtggaagttccagaagttgtctctccggatcaggaaatgccagtt
tacccgcctgccattgtcacgccacttcaggacgcggtcacttctgaggggcgcccagcg
cgtttccagtgccaagtttcagggacagatttgaaggtgtcttggtactgcagagacaag
aaaatcaaaccatctcggttcttcaggatgacacagtttgaagacacttaccagttggag
attgctgaagccttccctgaggacgaaggaacttacgctttcgttgctaataatgctgtg
ggccaagtgtccagcaccgccaccctgagactggaagcccctgagtcaattttacatgag
cagatcggccagcaaattgaaatggagatgaaagaaattgctagcattctgtctgccaag
gaagattttcaaacctatagttctgacctacctaatgagaatggaacacttgaacttctg
tctgggcctccagctcattccacccagtttgattccagacaggaaggcgctgtcccagtt
ttcatcaaagaaatatcagacgttgaaataagcattgaagacgtagctaaattgtctgtt
actgtcgttggctgccccaagcctaaaattcagtggttctttaatgggatgctattaacc
ccttctgctgactacaaatttgtctttgatgggaataaccacagcctaatcattctgttc
accagatttcaggatgagggggagtacacgtgcatggccagtaatgaatacggaagggca
gtatgtagtgctcacctaaaagtaagccctaaaggagagaggagcaaggacaagggatca
gtagtgaaggaaactctggagaagcctgaagaaccttgtttgccttactttctcaaggag
ttaaaacccgtgcactgtgctccaggaatcccggctgtctttgagtacttggtgcatgga
gagcctgcccccactgttttatggttcaaagaagacatgccgctttataccaacgtttgt
tacaccatcattcacaatcctgacggctctgggacctttattgttaatgaccctcagagg
ggagatagtggcctgtacatctgtaaggccgagaacctatgggggacatccacctgtacc
gcagagcttcttgtgcttccggaagacacagatgtgcccgatgcctcctgcaaggaagag
tccacctcaggagttcctggtgattttctggaaacatctgcaagaggcctttccgttcag
gcatttgactcagagcaggaaattacagcttttgccaagggtgctttagttgcagaggaa
aagctgcagcttccttatgagcataaggttgacagcagtgaactgggtactggggtgact
ctaggggctcagaagctgcaacccgttatcatgtccactctccagggcactggggagctg
ccttccatagatggtgccgttcacacacagccaggcaaagaaccgccccccactttacac
ctgcagactgtccagtctcagaggaccctccccaaggaagatactctacagtttgaagag
cctgaggaactctgcccaggtgcctcatctgcagcacaagtgagttcagtcaccgtcaag
cctctgataaccctaacagctgaacccaaagggaagtctccacagtcttcaacagcagct
cctgatggttcccttctgtcctctgtcactgaagaaacactccatctaggagaaaagatg
atcttggaagtggacaaagagcaaagagctctcctcctgagtcagagcatagctgagggg
tgtgtggaaagtttagaggcgcttgatgttgcagtctctgaggtgcgctctgagccccaa
gtcccttcccaacacacatgcatagaagaaggcaaaaccctgatggctagtgcagatact
ctcgaaagcacagggcaaaacgttgccctgaggaccgaggagggcaagtccctaagcttc
ccactagcacttgaggaaaagcaggtcctacttaaggaagagcaatcagaggtcatggca
gtgcccactagccaaacctctaagcctaagaaagagcccgaggcagtaaagggagtgaag
gaggtacaagaaagtgacctgctttctaaggaaacattgttttctagtattcccaaagag
cagcgactacatctgaaaactcaggtccgaagggctttgcaggctgccgtggccagggag
caagcaagtcttttctccgagtggctaagaaacattgacaaggtggaggtcacagccgta
aacttcactcaagagcccaaacgtatcctgtgcacctaccttatcacctcggtgaaatca
ctaacggaagagttaaccctcaccattgaagacatagatcctcagatggctaacctggaa
actgaacttaaggatgccttgtgctccattgtctgtgaagaaagaaacatcttaatggct
gaggatccgaggtttcaggaagaagacaaaataggtgtgcaagcagggagaggtcacctt
tcagatgcacagaaagttgaaactgtcatagaagctgaagtcgactcgaagtaccttgtc
cccaaagaagaggtcagctggttgaacgtggagagtcacttcaaagatggagataccgat
gaggttccacagactgagactctgaaggtggcagaagagggtgatacccagaagaccagt
acagtgaggtcacaagaagaagctgagggtcccttagctgacctttgccctactatactt
aaacccttagtggataccatttctgagaaaggagataccgtccaccttacgtcatccata
tcaaatgctaaggaggtgaactggtatttcaagggtgacctggtgcctccaggtgccaag
ttccagtgcctaaaagaggagaatgcatacaccctggtaatcgagtcagtaaagacagag
gacgaaggggagtatgtctgtgaagcctcaaacggcaatgggaaagcaatgacgtcagcc
aagctcactgtgggagaaagagctgcccctgtgatcaaaaggagaattgagcccttggaa
gtagctctgggccacctagccaaattcacctgtgagatccaaggagcccccaatgtccgg
ttccagtggttcaaagctggcagagagatttatgagagcgacaagtgttccattcgatct
tcgaactacatctccagcctggagatcctgaggacccaggtcgttgactgtggcgagtat
acctgcaaagcctccaacgagtatggcagtgtcagctgcaccgccacgctgaccgtgaca
gaggcgtatccaccaacctttctctccaggcccaagtcccttacgactttcgtgggtaag
gcagccaagtttctctgcacagtgtcagggactccggtgattgagaccatctggcagaaa
gacggtactgccctgtcgccgtcacctgactgccggatcacagacgcagacaacaagcac
agtttagaactctcaaatcttactgttcaggacaggggtgtttactcttgtaaggcttct
aacaaattcggagcagatatctgccaagccgagttgaccatcattgacaaaccccacttc
attaaagagttggagcctgtgcagtccgccatcaataagaagatccaccttgaatgccaa
gtagatgaggataggaaagttagcatcacgtggagcaaagatgggcaaaaactgcccgct
gggaaagactacaagatctattttgaagataaaatagcatcacttgagattcctctggcc
aaactcaaagattcgggaacctattcatgcacagcttccaatgaggctgggagcagttcc
tcgtctgccacagtcgcggtccgagaaccgccatccttcgtgaagaaggtggatccctct
tatttaatgctcccgggtgaatcagcgcgcctccattgcaagctgaaaggctcacctgtg
atccaggtcacttggttcaaaaataacaaagaacttagtgaaagcaacacggtccgcatg
tcttttgccaattctgaggctatcctcgacatcactgatgtaaaagttgatgacagcggc
acatactcctgtgaagccaccaatgacgcgggcagtgacagctgcagtactgaagtagtt
atcaaagagcctccctctttcatcaaaactcttgagcctgcacacatagtgcgaggggcc
aatgcactgcttcagtgtgaggtcgcgggcacgggacccttcgaagttagctggtttaaa
gacaagaagcaaatccgaagtagtaaaaagtacaggttgtttactcagaagacctttgtg
tttctggaaatcacatctttcaatagcgccgacattggcgattacgaatgtgtggtggct
aatgaagttggaaagtgtggctgtgttgccacacacttgctaaaagaaccaccaaccttt
gtcaagaaagtagatgactttacagccctagcaggacaaactgttaccttacaagctgcc
gtgagagggtcagaacccatttctgtcatgtggatgaaaggccaagaagtcattaaagag
gatggaaaaatcaaaatgagcttttccagtggagttgcagtcttgaccatctctgatgtt
cagatcggtttgggtggcaaatacacgtgcctagctgaaaacgaagctgggagccagacg
tctgtcggggagttgatagtgaaagaacctgccaaaatcattgagcgagcagaactgatc
caggtgaccgcaggggacccagccactctggagtacacagtctcgggcaccccagaactc
aagcccaagtggtacaaagacgggagacccttggttgctagtaaaaagtaccgaatcagt
tttaaaaacaacattgcccagctgaaattttattccgctgaactgcacgacagtggccag
tacacatttgagatttccaacgaagtgggtagcagctcatgtgagaccacgtttactgtg
ttagatcgagacatcgctccactattcaccaaacccttacgtaacgtggacagtgtcgtt
ggcggtgcctgcaggttagactgcaaaatcgccggctcactccccatgagggtttcctgg
tttaaggatggcaaggaaatcgctgcttctgacagataccagatagcatttgtggaaggc
acagcctctttggagatcagtagagtagacatgaacgacgcagggaatttcacctgtcgg
gccacaaattctgtgggcagcaaagacagcagaggagccctgattgtgcaagaaccaccc
agttttgtaactaagccagagtccagggatgttctgcctggctcggcagtctgtctgaag
agtgctttccaaggatccactccccttaccatcaggtggtttaagggcgacaaggagttg
gtttctggtgggagctgttatattaccaaagaagcctcagagagttccctggagctctac
gcagtgaaaaccacggattcgggcacttacacgtgcaaagtcagcaatgtagccgggagt
gtggagtgcagtgcaaacttgtttgtgaaaggtttgcattcttcttttgacacctttggg
cggccccgagaccctttctacataagcgtcttcctcttttctactgctcttcttaataat
tcccttccttccacagagcccgctacatttactgaaaagttagaaccatcacaactgtta
aagaaaggagatgccactcagctagtctgcaaagtcacgggcacccctccaattaagata
acgtggtttgcgaatgaccgagaactgagggagagcagcaaacacaagatgtcttttgtg
gagtccactgcggttttaaggcttaccgatgtggccattgaagacagtggggaatacatg
tgtgaggctcaaaacgaggctggcagtgaccactgcactagcattgtcatagtcaaagag
tcaccttactttaccaaggaatttaagtccattgaagtattaaaggagtatgatgtcatg
ctgctggccgaggtggcaggcacccctccctttgagatcacttggttcaaagacaacaca
acccttcgaagcggtagaaagtataaaaccttcattcaggatcagctggtgagcctgcag
atcctcaagtttgtagcttcagatgcaggtgaataccagtgccgggtgaccaacgaggtg
ggcagcagtacctgcagtgcccgggtgacattaagagaacccccgtccttcattaagaag
atcgaaaccaccagttccctccgtggaggtacagctgccttccaggccactctgaaaggc
tccttgccaatcactgtgacgtggttaaaagacaatgatgagatcaccgaagatgacaat
ataagaatgacttttgagaacaacgtggctagtctatacctcagtggtattgaagtcaag
catgatgggaaatatgtctgtcaagccaaaaatgatgcaggcatacaaaggtgttctgca
ttactctcagtgaaagaacctgcgacaataacagaggaagctgtgtccatagatgtcact
caaggagacccagccactttgcaagttaaattttcagggactaaggagatttcagccaaa
tggtttaaggatggccaagaacttaccctgggtccaaaatacaaaatcagtgtcactgac
acagtctcaatactaaagattatttccacagagaagaaagatagtggagaatatactttt
gaggtccaaaacgatgttgggagaagcagctgcaaggctagcattaatgtcttagatctt
attatacctccttcattcaccaaaaaactgagaaagatggacagcattaaagggtctttt
atcgacttagagtgtatagtggctggatcacatcccataagcatccaatggttcaaagac
gaccaagaaatctcagctagtgacaagtacaaattctcttttcatgacaatactgccttc
ttagagatcagtcagctggaaggcacagacagtggaacttacacctgttctgccaccaac
aaggcaggccacagccagtgcagtggtcacctgacagtcaaagaacccccttacttcgtg
gaaaagccacagtcacaagatgtgaatcccagcacaagggttcaattgaaggctcttgtg
ggtggcactgcacccatgacaataaagtggtttaaagataacaaggagctgcaccctggg
gcagctcgctcggtttggaaggatgacacctccaccattcttgaactcttttcagccaaa
gctgccgactccgggacctacatttgccagctaagcaatgatgttggcacgacaagcagt
aaagccaccatctttgtaaaagaacctcctcaattcattaagaagcccagcccagtgcta
gtgctgagaaatggacagtcaacaacatttgaatgccaagtaacaggcaccccggaaatc
agagtgtcttggtatttggatgggaatgaaataacagatcttaggagatacggcatttct
tttgtggatggtttagccactttccagatttctaatgccagggttgaaaatagtgggact
tacgtctgtgaagctcgaaatgacgcaggcactgcgagctgtagcatcgaactaaaagtg
aaagagcctcccatctttatcagggagctggagcctgtggaggtagtaaaggacagcgac
gtggaactagagtgtgaggtcatggggacaactccatttgaagtcacttggctgaagaat
aacaaggaaatcagaagtggcaaaaagtacacaatgtctgagaagatgtcagtgttttac
ctgcacataaccaagtgtgccccttcagatgttggtgaatatcagtgcatcatagccaac
gaaggaggcagctgtgcttgcactgcacgagttgccctgaaagaaccaccatcgttcatc
aagaagatagaaaatgtcaccaccgtcttgaagagttccgccacctttcagagcaccgtg
gcaggctcacctccgatttctataacttggctaaaagatgaccagattcttgaggaaaat
gacaatgtccatatttcttttgaggatagtgtggccacacttcaagtccggagtgtggac
aacgggcacagtgggcgatacacatgtcaagccaagaatgagtcaggagtggagaggtgt
tatgctttcctcttagtacaagaacctgctcaaatcatagagaaagctaagtcagttgat
gttaccgagaaagacccggtcaccttggagtgtgtggtggcaggaacaccagaactcaaa
gtcaaatggcttaaagatgggaaacagattgtacccagtagatatttttcaatgagtttt
gaaaataatgtggccagttttaggattcagtcagtaatgaagcaagacagtggacagtac
acgttcaaggtggaaaacgactttggaagcagtagctgtgatgcctacctaagagtgcta
gaccaagacattcctccatcgttcaccaaaaagttaaccaaaatggataaagttctggga
tcttctatccacatggagtgcaaggtttctgggtcacttcctatcaatgctcagtggttt
aaagatggaaaagaaatatctacaagtgcaaaatacagacttgtatgtcacgaaaatacc
gtgtcactggaagttagtaatctggaattagaagacactgcaaattatacctgcaaggtg
tccaatgtagcaggagacaatgcttgtagtggcatcttaactgtgaaagaaccaccaagc
ttcctagtgaaacctgagaggcagcaagctataccggattctacagtggaatttaaggct
gtgttgaaaggaacaccaccattcaaaattaaatggcttaaagatgatgtggaacttgtc
tcaggacctaagtgtttcattggcttggaagggtcaaccagcttcttaaacctctactca
gtggatgcttctaagactggacagtatacttgccaagttaccaatgatgttggtagcgac
tcttgcactacaatgttgcttgtgacagaaccaccgaagtttgtaaagaaattagaagct
tccaaaatagtaaaagcaggtgactcggcacgattggaatgcaagattactggatctcca
gaaattcgagttgtgtggtatagaaatgaacatgagctcacagccagtgataaataccag
atgacattcattgactcagtggcagtcatgcagatgaacagcctcgggacagaagacagt
ggggattttatctgtgaggctcagaatcctgctggcagcaccagctgcagtaccaaggtt
atagtaaaagaaccacccgtttttagtagctttccgcctgtagtagaaacccttaagaac
actgaagttagccttgagtgcgagctttcgggaacaccgccctttgaggtggtgtggtac
aaagacaagcgtcagctccgaagcagcaagaagtacaagatcgcatccaagaacttccac
gcgagcattcacatcctcaacgtggactcgacagacatcggtgaataccactgcaaagcc
cagaacgaagtgggcagtgacacttgcatctgtgctataaagttaaaagaaccaccaaaa
ttcatctccaagctgaacagcctcacggtggtggctggcgagcctgctgagctgcaagca
tccattgaaggtgccccgcccatttctgtgcactggcttaaagagaaagaagaagtggtc
agagagagcgagaacgttagaatttctttcgtcaacaacgtcgcgactctgcagtttgct
aaagcggagccagctaatgctgggaagtacatttgccaagtcaagaatgacggcggagtg
agggaaaacatggcctcgttgactgtcttagagcctgcggtcattgtagagaaggcaggg
tccatgacggtgaccgtgggagaaacgtgttccctggagtgtaaggtggctggcactccg
gagctgtctgttgagtggtataaggacggaaagctcttgaccagcagccaaaaacacaaa
tttagcttctacaacaaaatctcttccttgaaaattctctcagttgagaaggaagatgcc
ggtacctacacgttccaggttcagaacaatgttggaaaaagcagttgcacggctgtggtc
gatgtgtcagaccgaatggtccctccctctttcaccagaagactgaaggatattggtggc
gtcctgggcacctcttgcgtcttagaatgtaaagtggctggatcctctcctatctctatt
gcctggtttcatgagaaaactaagattgtcagtggagcaaagtaccaaacgacattttca
gataacgtctgcacattgcagttgaattctctggactcatcggacatgggcagttacaca
tgtgtggctgctaatgtggctgggtcggatgaatgtcgtgccctgttgaccgtacaagag
cctccctcttttgtgaaagaacctgaacccctggaaatccttccgggcaaaaacataacc
ttcacaagtgttatcagaggaacccctccattcaaggttggctggtttaggggtgccaga
gaattggtgaaaggagacaggtgcaatatttattttgaagacaccgtggcagaactggaa
ttatttaatatcgacgtatcccagagtggggaatacacctgcgtggtttctaacaatgcc
ggccaagcgtcctgcactacgcgtctctttgtgaaagaaccggccacatttgtaaagaag
ttaagtgatcactctgtagagccagggaagtctataattctggagggcacctatactggg
acacttccaatttctgtcacctggaaaaaagacggagttgtcataactccatctgaaaga
tgcaacattgtcaccacggagaaaacatgcatcctggagattctgaccagcaccaaagga
gatgcagggcactactcctgtgagattgaaaacgaggcaggaagggattcttgtgacgct
ctcgtatctacattagagcgccaactcccaccttcctttgcaagacagttgaaggacatt
gagcaaaccgttggcttaccagttaccctcacttgccgactaaatggctctgcgcccatc
cacgtgtgctggtatagagatggggtacttctaagggatgatgaaaatctgcagatgtca
tttgtggataatgtggcaacattaaaaattttgcaaaccgacctgagtcactctggccag
tattcctgctcggcttccaatccacttggcacagcatcttctacggctagactaacagca
agagaacctaagaaatcacccttctttgacatcaagccagtgtccatagatgttattgcc
ggagaaagtgcagattttgagtgtcacgtcactggcgctcaaccgatgagagtcacgtgg
tcaaaagataacaaggaaatccgacctggagggaactatactatcacgtgtgtgggcaac
actccccatctgaggattcttaaagtgggcaaaggagactctggtcaatacacttgtcaa
gccaccaatgatgttgggaaagacatgtgctctgctcagctcagtgtgaaagaacctccc
aagtttattaagaaattagatacttcaaaagttgccaagcagggagaatccatccaactg
gaatgcaagataagtggctctccagagatcaaagttgtgtggttccggaatgacagcgaa
cttcatgaaagctggaaatacaacatgtccttcgtgaattccgtggcactgctaaccatc
aacgaagccagtgttgaggacactggggactatatctgtgaagctcacaatggcgttggt
catgccagctgcagcacagccctgaaagttaaagctcctcctgtctttacccagaagcct
cctccagttggagccctgaaagggtctgatgtgatccttcagtgtgagatttcgggaacg
cccccctttgaggtggtgtgggttaaagatcggaaacaagtacggagcagcaagaaattt
aaagtcacctccaaaaattttgacacgagtcttcatatctttaatctggaagcccccgac
ataggggagtatcactgcaaagccactaacgaggtgggaagtgacacgtgtgcttgcacc
gtcaagttcaaagaaccaccccggtttgtgaaaaagctcagtgacgtgtccacccttatt
ggggatcctgtggaattacaagctgtggtggaaggtttccagccaatttccgttgtctgg
ctgaaagataaaggtgaagtcatcagggagagtgaaaacgttaggatttccttcgtggat
aacattgcaactctccaactgggaagtccagaagcatcgcattctggaaaatatgtttgc
caaatcaaaaacgatgccggaatgagagagtgttcggcactcctgactgtcctagaacca
gccaggattgtagagaaaccagaacccatgactgtgacgactggaaatcccttcacactg
gagtgtgtagtagctgggactccagaactttcagccaagtggttgaaagatggtagagaa
ctatcttcaggcagcagacatcacattacatttgtcagaaacctggcttcccttaagatc
ccctccgcagaaatgaatgacaagggcttatatagctttgaggtggaaaacagtgttggc
aaaagcagctgcactgtgtctgtccatgtctcagaccgagttgttccaccgtccttcatc
cgaaagcttaaggacacgactgccacgcttggggcctctgtggttttggagtgtcgggtg
tcaggctcggccccaatatcagtgggctggtttctggatggcaacgagatcatcagcagt
cccaaatgtcagcccagctttgcggataacgtctgcactctgactctgagctccctggag
ccctccgacacgggcgcatacacgtgcgtggctgccaatgtagctggtcaggatgagagc
tctgctcttctgactgtccaagaaccaccatcttttgaacaaacccctgactctgtggaa
gttttgcctggaatgagcctgaccttcaccagtgtctttagaggtacccctcccttcaag
gtcaagtggtttaagggcagcagggagttggagtcaggggaggcttgcaccatttcttta
gaagactttgtcactgagctggaactcctggaggtggagccgttgcagagtggagattac
tcttgcctcgtgaccaacgatgctggcagcgcgtcctgtaccacgcacctctttgtgaaa
gaaccagccactttcgtgaaaaggttggctgacaccagtgtggagacgggcagccccatc
gttctggaagccacgtactctggcacaccacctatcgccgtgagctggttgaagaatgaa
tatcctctgtcacagtctcctaactgtggcatcaccacgacagaaagatctagcatccta
gaaattcttgagagcacaatagaggactatgctcagtacgcttgcctgatagaaaatgaa
gccggacaggatatctgtgaagctcttgtgtctgtcctagaaccaccttactttatcgag
cccctggagcatgtggaagcagctattggcgagcccacaacgttacagtgtaaagtggac
ggaacgcctgaaatcagaatttcttggtataaggagcatacaaagctacggtccgctcct
gcgtataagatgcaattcaaaaacaacgtggcctccttagtcatcaacaaggtggaccac
agtgatgtgggagagtacacctgcaaggcagaaaacagtgtgggggctgttgcttcttcc
gccgtgctggtcatcaaagagcgtaaacttccaccttcctttgcgagaaagctgaaagat
gttcacgagactctcggcttcccagtcgcttttgaatgtcgaatcaatggctcggaacct
cttcaggtgtcttggtacaaggatggccaacttttaaaagatgattctaatttgcagatg
tcttttgttcatcatgttgccactctacagattttgcaaactgaccagagccatgttggt
cagtataattgttcagcctctaatcctcttgggactgcttcgtccagtgcgaagctcatc
ctgtcagaacatgaagtgcctcccttctttgacttaaagcctgtgtcagtagaccttgct
cttggtgaaagtggttcttttaaatgccatgtcactggaacagcaccaatcaaaatcacc
tgggctaaagataaccgtgagattcgccctggaggcaactacaagatgactctggttgaa
aatactgccactctgactgtgctcaaagtagccaaaggagacgctggacaatatacctgc
tacgccagcaacgttgctggaaaggactcttgttctgctcaacttggtgtacaagaaccc
cccaggttcattaagaagctagaccaatcacggatcgtgaagcaggatgagtatacaaga
tacgaatgcaagataggcgggtctccagaaatcaaggttttgtggtataaagatgaggtg
gaaattcaagaaagcagtaaattcagaatgtcattcgaggactcagtggccatcctggag
atgcacaatctcagtgttgaagacagtggggactatacctgtgaggctcgcaatgcagca
ggaagcgccagcagcagcacgtcgctgaaggttaaagaaccacctgtgttccgcaaaaag
ccttttccagttgagacacttaaaggagccgatgttcaccttgagtgcgagcttcaggga
acacctccctttcaagtttcttggtacaaagacaagagagaactcagaagtgggaagaag
tacaagattatgtctgagaatttgctcacaagcattcacatcctgaacgtggacacggca
gacatcggggaataccagtgcaaagccacaaacgatgtcgggagtgacacctgtgtgggt
tctgtcactctgaaagcaccaccacaatttgtgaagaaactcagcgacgtttctaccatc
attggcaaagaagtccagctacagacaacaattgagggcgctgagccgatttcggtggcg
tggttcaaagataaaggggaaatcgtcagagaaagtgacaacatctggatttctcattct
gaaaacgtcgcgaccctccatttctcaagagcagaaccagccaatgctgggaaatacacc
tgccagatcaagaatgacgcaggggtgcaggagtgctacgccacgctgtcagtgctcgag
cctgccacaatcgtggaaaagccagaatctattaaggtgactacaggagacacctgtacc
ttggagtgtatggtatctgggacacctgagctcagcaccaagtggtttaaggatggaaaa
gagctcacgggtgacagcaaatataagataagcttcttcaacaaagtgtccggcctcaaa
atcatcagcgtggcacctggcgacagtggggtgtacagctttgaagtgcaaaaccctgtg
ggcaaagacagctgcacagtctccattcaggtctcagaccgaatcatccctccctcgttc
acaagaaaactgaaagagacgaatggtctgtccggctcctccgttgtgatggagtgcaaa
gtgttcgggtcacccccaatctccgtcttgtggctccatgacgggaatgcgatcagcagt
ggccggaaataccagaccacactgacagacaacacctgtgccctaaccgtgaacatgctg
gaggatgctgacgccggcgactacacgtgtatagctaccaatgtggcgggctctgacgaa
tgcagtgcccccctgactgtgcgagagccaccatcttttgttcagaagccggacccgatg
gatgtcttgactggcagtaatgtcactttcacgagcattgtcaaaggaacacctcctttc
actgtcagctggttcaaaggcagcagcgagcttgtgcctggggccaggtgcaacgtgtct
ctgcaggactcggtggctgaactggagttgtttgatgtagatacatcccaaagtggagat
tacacctgcatagttagcaacgaggccggcagggcttcctgtacaacgcagctcttcgtg
aaagccccagccatatttgtgaagagactcaatgattacagcatagagaaaggcaagccc
ctcattctagaagggaccttctctggaactcctccgatctctgtcacatggaagaaaaat
ggcgtaaatgtcactgcttcccaacggtgtaatatcaccacaaccgaaaagtcagccatt
ctagaaattctgagcagcactgttgaggattccgggcagtacaactgctacattgaaaac
gcttctggcaaagattcctgctccgcccagatcctgatactagaaccgccgtatttcgtc
aagcagttggagcccctgaaagtgacagttggtgactctgcctctttgcaatgccagctt
gctgggactcccgaaattggggtctcctggtataaaggagacacaaagctaaggcccacc
accacctgcaagatgcattttaagaacaacgtggctacactggttttcacccaggttgac
agcaacgacagtggagaatatatctgcagggctgaaaacagtgtgggagaagtttcttca
tcaactttcctgactgttcaagagcaaaagcttccgccatccttttctcgacaactaaga
gatgtgcaagagacggtaggattgccagtggtttttgaatgtgccgtaagcgggtctgag
cccatctccgtgtcttggtacaaagacggcaagccgttgaaagacagcccaaacgtacaa
acatcatttttagacaacatcgccactctgaacatctttaagaccgacaggagcctggca
ggccagtactcttgcactgttacgaaccccatcggctctgcctcttcaagtgccaagctc
atcctcacagaggggaagaatccacccttctttgatatccctctggcccctgtggatgct
gtggtgggagaaagtgctgacttggaatgccatgtcacaggaacacagcccatcaaggtc
acctgggccaaggacaacagagagatacgaagtggtggtaactaccaaatcagctatctg
gaaaacagtgcgcacctgaccattgtcaaagtggacaaaggtgactctggacagtacacc
tgctatgccatcaatgaagtgggaaaagactcctgcacagcccagcttaacataaaagag
cgcctcaccccaccgagtttcactaaaaagctctcggagacgatagaagagacggaaggg
aactcattcaaactggaagggcgtgtggcagggtcccagcccatcaccattgcttggtac
aaaaataacgtggagatccacccgacctccaactgcgagatcacgttcaagaacaacgct
ctgctgctgcaagtcaagaaagccagcatggccgacgcgggcttgtacacctgcaaggca
acaaatgacgcaggctccgccctgtgtacgtcatccatagtcatcagagagcctaagaag
cctcctgtgtttgaccaacaccttaccccagtaacagccagcgaaggcgatttcctgcag
ctcagctgccatgtgcagggatccgagcccattcgcatccagtggttgagagccggcagg
gagataaagccctcggacagatgcagcttcagcttcgctagcgggacagctgtgctggaa
ctcaaagacacagctaaggcagattcgggagattacgtgtgtaaggcttccaacgtggct
gggagtgacacttcaaagtgcaaagtgaccattaaagaaaaaccagctgcggccccagca
gccaagaaagccgctgtggatggaaaactcttcttcgtgtcagagcctcagagtatcaga
gtggtggagaaaaccactgctacctttattgcaaaagttggaggtgacccgatcccgaat
gtcaaatggacgaaagggaagtggagacaactgaaccaggggggtcgaattcttatccat
caaaagggtgacgaatcaaagctggagattcgtgacaccacaaaaaccgattctggctta
taccgctgcgttgcctttaacaagcacggcgaaattgagagcaatgtcaacctgcaggtg
gacgagagaaagaagcaagagaagattgaaggtgatctccgtgcgatgctgaaaaagact
ccagccttaaagaaagggtctggggaagaagaggaaattgacatcatggagcttctcaaa
aatgtggaccctaaagagtatgagaaatacgctcgcatgtatggaatcaccgacttccgt
ggcctcctgcaagcatttgagctgctgaaacagagtcaggaagaagagactcacagactg
gaaattgaggaactagagaagtcagaaagagatgaaaaggaatttgaagaacttgtatca
tttattcagcagaggctgacacagaccgagcccgtcaccttgatcaaggatattgaaaat
cagactgttctgaaagataatgatgccatctttgaaattgacattaagattaattatcca
gaaatcaagctctcctggtacaaagggactgagaagctggagcccagtaacaaatacgaa
ataaccattaatggggaccggcacacgctcagagtcagaaactgtcagcttaaagatcag
ggcaattacaggctggtctgtggtcctcacatcgctagtgccaagctaactgtgattgag
cccgcgtgggagcggcacctccaggacgttactttgaaagaaggccagacgtgtaccatg
acgtgtcaattttctgtaccaaatgtgaaatctgagtggttcagaaatggcagagtcctt
aaacctcaaggcagagtgaaaacagaggtggaacacaaggtccacaagctgaccattgcc
gatgtccgtgcggaggaccagggtcggtacacctgcaagcacgaagaccttgaaacttcg
gcagagctcagaatcgaagccgagccgattcagtttacaaagcgcatacagaacatcgtg
gtgagcgagcatcagtcggccacttttgagtgtgaagtgtcctttgacgatgccatcgtc
acctggtacaaaggaccgacagagctgactgagagccagaagtacaacttcaggaacgac
ggccgctgccattacatgacgatccacaatgtgaccccagatgacgaaggcgtctattcc
gtcattgctcggctggagccgagaggtgaagcaagaagcacggcggaactgtacttaacg
accaaagaaatcccccctgcggttgctccttccattcctcttctgctgccattacctgaa
gagaagaagccaccagcaaaacgaattgaagtcccagaagttgccaagaagcctccacct
cctactcccatgattccagcaaaaccatctgaaattattgacgtgtcctctaaggctgaa
gaggtaaaaataacaaccatcaccagaaagaaagagattcataaagaaaaagaggctgtg
tatgaacggaaggaagcagtctacgaaaagaaagttctcatagagccttgggaagagccc
tatgaggagctggaaacagagccgtacacagagccgtatgaggaaccgtattatgaagaa
ccagatgaagactatgaggagatcaaggtggaagctaaaaaggaagtccacgaggaatgg
gaggaagactatgaagaaggacaggaatactatgagagagaagagggctacgatgaaggg
gaggaagagtgggaagagatttaccatgaaagggaaataattcaggttcagaaggaggtt
cacgaagttgtaaagaagccagtagttgaaaaaattgaaaagactactcgaagaatggag
gaagaaaaagttcaagtcaccaaagtaaattacaattgccaccctcagcatgagctatca
gtaattaagatgtatattttcttaaaagtccccgaggtacaaaagaaaactgtcactgaa
gagaaaattcacgttgcagtttccaaaaagatcgaaccaccacccaaagttcccgaggct
cccaagaaacctgtgccggaggagaagaagccagttcctattcccaagaaagagccagct
gcccctccgaaagtcccagaggctccaaagaaacctgctcctgaagagaagactgccgtt
cctgtggcaaagaagaaggaagcccccccacctaaagcgccacccaagaaacccgttcct
gaggaggttgttccagttcccatccctaagaaagctcctccccgagctgaggtttctaag
aaaactgttgtagaagagaaaaagtttgctgctgaagaaagactatctatggcggttcct
cagagagtggaactcatgcggcacgaagaggaggaatggacttactctgaagaagaggaa
caggtgtctgtttcggtgtatagggaagaggaaagagatgaggaggaagcagagatcaca
gaatatgaagtgttggaagagcctgaggagtatgttgtggaagaaaagctgcacgttatc
tctaagagagtagaagttgagccagccaaagtgcctgagaagcatgaaaagaaaattata
ccaagaccaaaagttcctgctaaaattgaggagcctccacccactaaagcacctgaagaa
ccaaagaaaccggttccagaaaggagagttcctgcagaagtggttgagatagaagaacct
cccccaaccaaagtgaccgaaaagcacatgaaaattacccaggaggaaaaggttcttgtg
gctgtaactaaaaaggaggagcctccgagagcaagagaagtaactgtaacagaagagaag
aaatggtcttacacccgagaagaagaaactgttctggaacaccgggaggaggaatacgag
gattatgaggactatgaggagtataaagagtatgaggagtacgagcccacagaagaatat
gaccagtacgatgaatatgcagagcgtgagctagaacactacgaggaggctaaagagcag
gaggaatacgtcgtcccaggtatggcggccctgcagaccacactaaacatgcttagaacc
cactacgctcctgaagaaccaaagaaagttgtggaagaaaaaatacaaatttcaattacc
aaacgtgaaaagcagcaggtgactgaaccagttgccaaagtgccaggggtgcctaaaaaa
cgagaaccagaagaggtcgtcatcttcaaagaagaggtagaagcccacgaagaagaatac
atcgtagaggaagaagaggagtacgtccacgaagaggagtacgtccatgaagaagaatac
attcatgaagaagagtacgtccatgaagaggaatatatccatgaggaggaggagtacctc
catgaagaggaggtcatagctgaggaagaggtgctgccagtagccccagttaaagtgccc
gtggtacccaagaaacctgttccggaagagaaaaaacccgttcctgttcccaaaaagaag
gaagcacccccggccaaagtgcctgagattcccaagaagcctgaggaaaaagtttctgtg
cctgttcctaaaaaggagaaggctccgcctgccaaagtcccggaagtgcccaagaaacct
gtaccagaggagaaggcaccagtacctgttcccaaaaaggtggaaccaccaccagccaaa
gtgccagaagtacccaagaaacctgtgcctgagaagaaggtgccggcgcctactcccaag
aaagtagaggccccgccagcaaaagtgccaaagaaacgggaagtagtcccagttcctgtg
gctctgcctcgggaagaagaagaagaagaagctccattcgaggaagtcactgttcctgaa
gaggaaattctacctgaggaagaagttccacctgaggaagaggaagttcttccagaggaa
gaagaagttcttcctgaggaagaggaagttccacctgaggaagaagaagctcttccagaa
attaagcctaaggtgccaaaacctgcaccagtgccaaagaaaactgtacccgagaagaaa
gtccccgttcctgttgctaaaaaagtggagcctccaccacctcccaaagtgccggagatc
aagaagaaagtgccagagaagaaagtagttgttcccaagaaagaggaggctcctcccacc
aaagttcctgtggtgcctaagaaacctgaaccagaaaagaaggtgcctgcccctgccctt
aagaaagcggtggttcctcctgccaaagtctatgaggaagctgaagagcctactccggag
gaaactccagaagagcctcctagcatagaggaagaagagatagtggaggaagaggaggag
gaggaggtgcccccgcccagagcaccagaagtagtgaagaaagctgtgcctgcagcaccc
gctcctgtccccaagaaagccgaggcgccccccacaaaagtgcccgaagtaccagcaaaa
gttccagaaaagaagaagatccccgaaaagaaagtccctgtacccaaaaaggaagctgtg
ccccctgctaaagggaaagctgtttttgaggaaaaaatatcagttgcctaccagcaagaa
gaacgagtccaagagagaatagagctagagctcgtggaagcacaagtggaggaggccttc
gaagaagagcagttccacgaggtacaggagtactttgaggaagaggagttccacgaggtg
gaggaattcatccgggtggaagagcgcaggttccaagaagaacacaaagtggaagaagtc
cacagggtcattgagtttctagaggctgaagaagtggaagtccacgaaaaacccaaaatt
ccacctaaaaaagcacctgaggtgaccaagaaaatggtggttgaagaaaaagtccgtgtt
cctgaagaaccgaaggtgccagcacctaaagtttatgaagcatctgaagagacagtcata
gaagaagaacatgtgattcaccctcagaaggcaagactcaaagtggcgaaaggaccccag
cagcaacagaaaaagcaccttggttcactttgtgggaataatgtctctactgaccattta
acctctgattctgatactaatatcttcaaagcaccagaagctatgagagagatgactcct
gaaatgaacacctttgaagataattctgcagagccagaaacgccacctgttcaagtgcgg
gacacttaccaagaagccacggttgaaaagaaaacacttcggatttctcgcaaaaagcct
gagcttcctccagatgaagctcctaaatgtcaaaatattaatatctttaaagtgcccgag
gctcccagagaagttgtggccaaaaagaaagtgccccctccccaagtgcctgaagttgta
cctgtgaaagtgccagaggagcccaaagaggtcatccctgaaaagaaagtgtccctggtg
cccgctaaaaagccggcagccccacccaccacagtgcctgaggcacacgaagaggacttc
cctgaagaggaagtgcccctggtgctccctcaagagccggaagccccacctgccaaagtg
ccagagcctcccaaagaagttgttcctgaaaagaaagtgtccatggtgcctccaaaaagg
ccagaagccccacctgccaaagtgcctgaggcacccaaggaagttgtccctgagaagaaa
gtgtcagtagcacctaagaaaaagccagaagccccagctgtgaaaggggccatccctggt
cctaaggatgatttcactatctctttcaagtgccagaggcacccaagaaagttgtccctg
agaagaaagtgcctgttgcagctcctaagaagcctgaagccccggctgctgaaggaaaat
actaatatctttaaagtgcctgaggtgccaaaggcagctgttccccaaaagaagatcccc
gaggccgttccccccaaaccagaaagtcctccccctgaagcgcctgaagtgccacccaag
gaagtcactccagaaaagaaagttccggtggttcctccaaagaagcccgaggctccacct
ccgaaagtacctgaaacccctcaagaagctgtctcagaagagaaaacccccaaggcactc
cccaaaaaggcagaagctgcccctgttccagtacccgaagaccaagaaactgtccctgaa
aagacaagaccagtggcccctcctaagaagccagaagtcacacctgtgccagtgccagag
gagcccaaagaggtcatccctgaaaagaaagtgtccctggtgcccgctaaaaagccggca
gccccacccaccacagtgcctgaggcacacgaagaggacttccctgaagaggaagtgccc
ctggtgccccctcaagagccggaagccccacctgccaaagtgccagagcctcccaaagaa
gttgttcctgaaaagaaagtgtccatggtgcctccaaaaaggccagaagccccacctgcc
aaagtgcctgaggcatccaaggaagttgtccctgagaagaaagtgtcagtagcacctaag
aaaaagccagaagccccagctgtgaaaggggccatccctggtcctaaggatgatttcact
atctctttcaagtgccagaggcacccaagaaagttgtccctgagaagaaagtgcctgttg
cagctcctaagaagcctgaagccccggctgctgaaggaaaatactaatatctttaaagtg
cctgaggtgccaaaggcagctgttccccaaaagaagatccccgaggccgttccccccaaa
ccagaaagtcctccccctgaaggggctactgtctttaaagtgtatgaggagcctgcagag
gagattgttccagaagagcctccagaggaggtcgtggaagaaccagagccagctccacct
cccaaagtgacagtgccacctaagaagcctgtccctgagaagaaagcgccccctgctgtt
gtcaagaaacccgaacccccaccagcgaaagcgcctgaagtacctaaggaagctccccct
gaaaagaaagtgccttctgtggttcccaaaaagccagaggccccacctgctaaagtgcca
gaagttccgaaagaagtggtcccagaaaagaaagtggctgttcccaaaaagccagaagtc
ccaccagccaaagtgccagaggtgccaaagaaaccagtcgttgaagagaagccagtcatt
gaagagaaaccagccattcctgttgccgagaaagtcgaatctcctcccacagaagtatat
gaagaaccggaagaagtcgccgctcaggaggaggagccagcccccgttgtagaagaggaa
gaatacgaagctccacctccacctgcaccagtgcctgaagagcctaagaaggttgtccca
gaaaagaaatatcctgtcatcaaaaagccagaacctccacctcctaaagtacctgaggtg
tcaaagaagcctgcgccgatgaagaaagttccggtcgttaagaagccagaaccaccagaa
gctgaagtgccggaagcacccaagaaaattaccccagaaaagagagagtctgctcctgtg
cctgaagagccagaggcacctcccgccccagtggaagagattcctgaggagacaatctat
gaagagaaagccaccattaccattggtagaaaagagacgccccctgttgaagaacgtgaa
attgaaaggtttatccaacctgaagaacccggaatggaaccacagccagaagaaacccca
gtgcaagaaccagagcctgaaaagaaggttatcgagaaaccaaagctcaaaccaaggccc
ccaatacgcgctccttccccacctaaggaagatgtgaaggagaagatattccaacttaaa
gctgtttcgaagaagaaagttcctgaaaaacccgaggttgtggaaaaagtggagcctaca
ccgctaaaagtgcccacagctgaaaagaaagttcgcaaattactgcctgaacccaagcct
cagccaaaggaggaggtggtgctgaaaagcgttctaagaaagagacccgaagaagaagaa
cctaaagtagaacctaaaaaagtagaaaaagttaaaaaaccagaagagccaccaccacct
ccaaaagctgttgaggtcgaagctcctccagagcctaagccaaaggaaaggaaagttcca
gaaccaaccaaagaggtgaaaaccatgaaagcgccacccatagagcccgcgcccactccc
atcgccgcccccgttacagctcctgttgttggaaagaaagcagaagccaaacctaaggat
gaggccgccaagccaaaaggtcccatcaaaggtgtagccaaaaagactccttcaccaata
gaagccgaaaggaaaaagctcagaccaggaagcggtggagagaaacctccagatgaagcc
ccgttcacctaccaactgaaagccgtgccactgaaattcgtgaaagaaatcaaagacatc
gttttgacagaggcagagtccgtgggctcttctgccatcttcgaatgtttggtctcccca
tccacagccattacaacttggatgaaggacggcagcaacatccgggaaagcccaaagcac
agatttattgcagatggcaaagacaggaagctgcatatcatagacgttcagctttccgat
gctggtgaatacacctgcgtgctacgtttgggaaataaagaaaagacctccactgctaag
ctcatcgtagaagaacttcccgtgcgctttgtgaagacactggaggaggaagtcacggtg
gtcaaggggcagccgttgtacttgagctgtgagttgaacaaggagcgcgacgtggtctgg
aggaaggatggtaagatcgtggtggagaaacctggcaggattgtgcctggtgtcattggc
ctgatgcgggccctgaccatcaatgacgcagacgacactgatgccggaacatacaccgtg
accgtggaaaatgccaacaacctggaatgttcttcctgtgtaaaagtagtagaaatcatc
agagaatggcttgtgaaacctatccgagatcagcacgtgaagcccaaggggacagctgtt
ttcacctgtcacatagccaaggacacgccaaacatcaagtggttcaaaggctatgacgag
atccccttggaacccaatgacaagactgagatactgaaggagggaaaccatctcattctc
aaagttaagaatgctatgccagaagatattgatgagtacgcggtggaaattgaagggaaa
agatacccggcaaagctgacccttggagagcgtgatgtcgagctgctgaagcccatagaa
gatgtcaccatttatgagaaggagagtgccagcttcgatgctgagatctcagaggaagac
attcccggggagtggaagctgaagggagagcttctgcggccgtcacctacttgtgaaatc
aaagctgaaggtggaaagcgcttcttaactttacacaaagtgaaactggaccaagctgga
gaagtcctctaccaggcctgcaatgcagtcacaaccgccattctgacagtcaaagaaatc
gagcttgactttgctgtacccctgaaggatgtgactgtcccagagaagaggcaggctcgg
tttgaatgtgtcctcaccagagaggcaaacgtcatatggtctaaagggcctgacataatc
aaggcatctgacaaatttgatattattgctgatggaaagaaacacattcttgtcatcaac
gactctcagtttgacgatgaaggtgtctatactgcagaggtggagggcaagaagacatca
gcacaattattcgtgacaggcataagactgaagttcatatcgcctctggaagaccaaaca
gtaaaagaaggccaaacggcaacttttgtctgtgagctctctcacgagaaaatgcacgtg
gtctggttcaaaaacgatgtcaagctgcacacaacgaggacggtgctcatgtcgtccgag
ggaaagacttataagctggagataagggagacgacgctggatgatatctcccagatcaaa
gctcaagtgaagaaccttagctccacagccaatctgaaggtcttggaggccgatccctac
ttcacggtgaaattacacgacaagactggcgtggagaaggatgagatcatcctcaagtgt
gaagtgagtaaagatgtgccggtcaaatggttcaaagacggggaagagatcgtgccttcg
cccaaacattccgtcaagaccgacggcctgcgccgaatcttaaagatcaagaaggcggag
ctgaaagacaaaggggagtacacctgtgactgcggcacggacaccaccaaggccaacgtc
actgtggaggcccgactcataaaagtggaaaagcctctgtacggtgtggaagtgtttgtg
ggtgaaaccgcccgcttcgagattgaactgtctgagcctgacgtgcatggccagtggaag
ttaaagggagagcccctgactgcttctcctgactgcgaaatcattgaggatgggaagaaa
cacgtcttggttctgtataactgccagctggacatgaccggggaggtatccttccaggct
gccaatgctaaatcagcagccaacctgaaagtgaaagaactgccgctcattttcatcacc
cccctgagcgacgtcaaagtctttgagaaagatgaggccaaatttgagtgtgaggtatcc
agggagcccaaaacattccgttggctgaaaggaacccaggaaatcgccggtgatgacaga
tttgagctcatcaaggatggcaccaggcattcattggtgatcaagtcggcggcctttgaa
gacgaagccaagtacatgtttgaagctgaagataaacgcacgagtggcaaactgatcatt
gaaggaatccgcctcaaattcctgaccccactcaaggatgtgacagccaaagaaagggaa
aacgcggtgtttactgtggagctgtcccatgacaacatccctgtgagctggttcaagaac
gaccagcgcctgcacaccagcaagcgggtctccatgcacgacgaagggaaaacgcactca
atcacgttcaaagacctgtccattgacgacacctcccagattagagtggaggccatgggg
ataagttcggaagctaaactcaccgtgctggagggagacccatacttcacagggaagctt
caagattacaccggcgtggagaaggatgaagtggttcttcagtgtgaaatcagcaaagca
gacgcgcctgtgaaatggtttaaggacgggaaggaaatcaagccgtcgaaaaacgcagtc
atcaaggctgacggcaagaagcgcatgctgatcctcaagaaagccctgaaatcagatatc
ggccagtatacctgtgactgcgggacagaccagacctccggcaagctggacatcgaggat
cgggaaattaaactggtgcgacccctgtacagcgtggaggtgatggagaccgagacggct
cgcttcgagaccgaaatctccgaggatgacatccacgccaactggaaactcaagggagag
gcgctgctccagacacctgaatgtgaaattaaagaagaaggcaagatacatgtccttatc
ttacacaactgccgcctagaccagactggaggcgtagatttccaggctgccaacgtcaaa
tctagtgcccacctccgagttaaaccacgggtaattggtctgctgaggcctctgaaggat
gttacagtgacggcaggagaaacagccacctttgactgtgagctctcctatgaggatatc
ccagtggaatggtacctcaaagggaagaagctggagcctaatgataaggtggtgacacgt
tcagaaggaagagttcacacgctcaccctgagggatgtgaagctagaagatgctggtgaa
gtccaactgacagcaaaggatttcaaaactcaggccaatctctttgtgaaagaacctccg
gttgagttcactaagcctcttgaggaccagacggtcgaagaggaggccactgcagtattg
gagtgtgaagtatccagagaaaatgccaaagtgaaatggttcaagaatgggacagaaatc
ctcaaaagcaagaagtatgaaatcgttgctgacggcagggtcaggaaactcattattcat
ggttgtacgccagaggatatcaaaacgtacacttgtgatgctaaggactttaagacctcc
tgtaacctgaatgtcattcctcctcatgtggaattcttaagaccactcacagaccttcaa
gttaaagaaaaagaaacggctcgctttgagtgtgaaatttccaaggaaaatgtaaaggtt
cagtggtttaaagatggtgctgaaattaaaaagggcaaaaagtatgacatcatttctaag
ggagcagtacgaattcttgtcatcaacaaatgtctactgaatgatgaagcagaatattcc
tgtgaagtgaggacagcaagaacttccggcatgctgacagtcctagaggaagaagctgtc
ttcaccaaaaatcttgccaacctcgaagttagtgaaggagacaccatcaaactggtatgt
gaagtctccaagcctggggcagaagtgacttggtacaaaggggatgaggaggtcattgaa
acgggaagatttgaaatacttaccgatggaaggaagagaatcttgatcattcagaatgca
cagcttgaggatgcgggcagctacaactgccgactcccaagttcccggacagacggcaaa
gtcaaagtacacgaacttgctgctgaattcatctcaaagcctcaaaaccttgagattctt
gaaggagaaaaggccgagtttgtctgcactatctcgaaggaaagcttcgaggtccagtgg
aagagggacgaccagacgcttgagtctggagacaaatacgacatcattgctgatggcaaa
aagagagtcctcgttgtgaaagatgccacattacaagacatgggcacttatgtggtcatg
gttggggctgccagagctgcagctcacctcacagtcattgaaaaactcaggatcgtagtt
cctctcaaggacaccaaagtgaaggaacaacaagaggctgtcttcaactgtgaagtcaac
accgaaggtgccaaagccaaatggttcaggaatgatgaagccatatttgacagttcaaaa
tatatcattctccaaaaagacctggtctacaccctccgaatcagagatgcacggttagat
gaccaagccaacttcagtgtgtctttgaccaatcacagaggtgaaaatgttaaaagtgca
gccaatctcatagtggaagaggaagatcttaggattatcgaaccccttaaagatattgaa
acaatggagaagaagtcagtcacgttctggtgcaaggtgaatcgtctcaatgtaaccctg
aagtggaccaaaaatggggaagaagtggcttttgacaaccgtatatcataccgcattgac
aagtacaagcactctctaatcatcaaggactgtggcttcccagatgaaggtgaatacatc
gttactgctggtcaagataaatccgtggcagagctgctcatcatcgaagccccaacggaa
ttcgtggagcacctggaagaccagacggtcacagagtttgacgacgctgtcttctcctgc
cagctctccagagagaaagcaaatgtaaaatggtaccgaaatggaagagaaatcaaggaa
ggcaaaaaatacaaatttgaaaaagacgggagcatacacaggctcatcataaaggactgc
aggctggaggatgagtgtgaatatgcttgtggcgtagaggaccggaagtccagagccaga
ctttttgtcgaagaaatcccagttgagatcatcaggcctcctcaagacattcttgaagcc
cctggtgcagatgttatcttcttggctgagctcaacaaagataaagtggaggtccaatgg
cttagaaataacatgattgttgtccagggtgacaagcaccagatgatgactccacctaaa
atcaagacatctgatcaagatctcgtggttgacgctggccagcctctgacaatggtggtg
ccctatgatgcctaccccaaagcagaagctgaatggtttaaagaaaacgaacctctttct
acaaaaaccgttgacactacagctgagcagacttctttcagaatcttagaagccaagaag
gaagacaaggggaggtataaaatcgtgcttcagaacaagcatgggaaagcggaaggcttc
atcaacttacaagttattgatgttcccgggccagttcgtaacttagaagtgacagaaaca
tttgatggcgaagtaagcctcgcttgggaagaaccattaacggacggtgggagcaaaatc
ataggttatgtcgttgaaaggcgtgatatcaagagaaagacctgggttctggtcactgac
cgggcagacagttgtgagttcactgtcactggactacagaaaggaggagtggaatacctg
tttcgtgtgagtgcaaggaacagagttggcactggagaacccgtggagactgacagtcct
gtagaagcaaggagtaaatatgatgttccaggccctcctttgaatgtaaccatcactgat
gtgaatagatttggtgtctccctgacatgggagccaccagagtatgatgggggagccgaa
atcaccaactatgtgattgaactgagagacaagacttctatcagatgggacactgccatg
actgtaagagctgaagatctgtcagcaacggtcactgacgtggttgaaggacaggagtat
agtttccgtgtcagagcccagaaccgaatcggagttgggaaaccaagtgcagccacacca
tttgtcaaagttgccgatccaatagagagaccaagtcctcctgtgaacctaagtgcctca
gaacagacacagtcatcagttcagcttacatgggagcctcctctgaaagatggcggcagc
cccatactgggctatataatcgaaagacaagaagaaggaaaagataattggattcgctgc
aatatgaaacctgtccctgagctgacttacaaggtcactggattacaaaaagggaacaaa
tatttatatagagtatctgcagaaaatgcagctggtgtttcagatccatccgagatcctt
ggtcctctcactgccgatgatgcctctgttgaaccaacaatggacttaagtgcatttaaa
gatggtctggaagtcatagtccccaatcccatcaagattctagtcccaagtacaggctac
ccaagaccaaaagcaacctggactttcggagatcaagtacttgaagcaggggaccgtgtg
aaaataaagaccatatcagcctatgctgaacttatcatttctccaagtgaacgaccagac
aagggcatttacacgctcacattagaaaatcctgtgaagtcaatttctggagaaattgat
gtcaacgtaattgctcgtccaagtgcacccaaagaactgaaatttagcgacgtaacaaag
gattctgtccatttgacttgggaaccaccagatgatgatggaggaagtccactaactgga
tatgttgttgaaaagagagatatgagccggaaaacgtggactaaagttatggactttgtt
actgatctagaattcacagttcctgatcttgttcaaggaaaggaatatctattcaaagtc
tgtgctcgaaacaagtgtggccctggagagcctgcatatactgatgagcctgtcaatatg
tctgcccctgcaacggtccctgacccaccagagaatgtaaagtggagagacagaactgcc
aacagcatcttcctgacctgggatcctcctaaaaatgatggtggctcacgcatcaaagga
tacatagttgaaaaatgtccacgtggttctgataaatgggttgcctgtggggaacctgtt
ccagatacaaaaatggaagtgacaggtctagaagagggaaaatggtacgcctaccgcgtg
aaggccttgaacaggcaaggagctagcaagccaagcaaacccacagaagaaatccaggcg
gtggacactcaggaggctcctgagatcttccttgatgtgaagctcctggctggcctcact
gtgaaagctggaacaaagatcgaacttcctgctacggtgactggaaaaccggagcccaaa
ataacttggacaaaggctgatacccttctgaggccagaccaaagaatcaccattgaaaat
gttcctaagaaatccacagtgacaatcacggacagcaagagaagtgatacgggcacatat
atcatagaagctgtgaacgtctgcggccgggccactgctgtggtggaagtgaatgtctta
gataaacccggaccgccagctgcttttgacatcacggatgtaaccaatgagtcctgtctg
ctgacctggaacccaccaagagacgatggtgggtcaaagatcacaaactatgttgtggaa
agaaaagcaacagatagtgacgtgtggcataagctctcatcaactgttaaggacacaaac
ttcaaggcgaccaaattgacccccaacaaagagtacatcttcagagtcgctgcagaaaac
atgtacggcgtcggtgagcccgttcaggctactccaataatagccaaatatcagtttgat
ccacctggacctccaactcgcctagaaccttccgacatcaccaaagatgcggtgacactc
acgtggtgtgagccggatgacgatggtggcagccccatcactggatactgggttgaaaga
ttagatcctgacaccgataagtgggttcgatgcaataagatgccagtgaaggacacaaca
tacagggtgaaaggcctcaccaataagaaaaaatacagattccgcgtgcttgctgaaaac
ttggcaggaccagggaaaccaaatcctccatggccccctggaaaaccaactgtaaaggat
ataggcaaaacctcattagtattgaactggaccaagccagaacacgatggaggggcaaag
attgagtcttacgtcattgagatgctaaagactggaacagatgactgggtcagagtggct
gagggagttccgaccactgagcatttgctcacagggctgatggaaggccaggaatactca
ttccgagtgagagctgtgaacaaggctggagagagtgagcccagtgaacccagcgaccct
gtgctttgccgggagaaactatatcctccatcaccacctcgctggctcgaagtgattaat
atcacaaaaaatacagctgacctgaaatggacagttcctgagaaagacggagggtcaccc
atcaccaactacatcgtggaaaagagagacgtgaggcggaaaggctggcaaaccgtggac
accacggtcaaggacaccaagtgcacagtaaccccactgacagagggttctctgtatgtg
ttcagagttgctgcagaaaatgccataggacaaagtgactacacagaaatcggagattcc
gtcctggccaaagacaccttcaccacccctggaccaccctatgccctgacagtggttgat
gtgacaaaacgacatgttgacctaaagtgggagccacctaaaaacgatggcggaagacca
atacagagatacatcattgagaagaaagaaaaattaggtacccgttgggtgaaagctgga
aagacctcaggccctgactgtaacttcagagtaactgatgtcatcgaaggaacacagcaa
gtcncagttctcaagttcgggcagaaaacgaagcaggagttggtcacccaagtgagccca
cagaaattctgtcaattgaagatcctgttggtaagtcatactgattattcaaagaaatta
tctaagggcctgatgatgagactgtggtatcaatgcatcactgtcttcccaggtcctccg
tcacctccacttgatctgcatgtgactgatgctgggagaaagcacattgccattgcttgg
aaacctccagagaaaaatggcggaagtcctatcataggctaccatgttgaaatgtgtcca
gtaggcaccgaaaaatggatgcgagttaattctcgcccaataaaagatttgaagttcaaa
gttgaagagggtgttgttccggacaaagaatatgttctgagagtgagagctgtcaatgct
gtcggtgtcagtgacccatctgaaatctctgaaaacgtggtcgccaaagacccagactgc
aaaccaaccattgatctagagactcacgacattgttgttatcgaaggtgaaaagttaagc
atccctgtgcccttcagggctgtcccagtgccaaccgtgagctggcataaagatggcaaa
gaagttaaagccagtgacagattgacaatgaagaacgaccacatctctgcacacctcgag
gttcccaagagtgtccatgcagatgctggagtttacaccatcactctggagaataagctc
ggctcagcaaccgcgtcaatcaacgtcaaagtcataggtctacctggcccatgcaaagat
attaaagcaagtgacataaccaagagttcttgtaagttaacatgggagcctccggagttt
gatggtggaagcccaattcttcactatgtcctggaacggagagaagcagggaggaggaca
tatataccagtcatgtctggtgagaacaaactgtcttggaccgtgaaagatctcatacca
aatggtgaatacttcttccgagtaaaagcagtcaacaagattggcggaggcgaatacatt
gaactcaagaatcctgtcattgctcaagatccaaagcaacctcctgatccacctgtagat
gttgaggttcataatcctacagctaaggccatgactatcacatggaaaccacctttgtac
gatggaggaagcaagataatgggttacatcatagaaaagcttgccaagggtgaggacagg
tggaagaggtgcaatgaacatctggtccctgtcctgacctacacagcaaaaggactcgag
gaagggaaagagtaccaattccgtgtgcgagcggagaatgctgctggcattggcgaacct
tcccgggccactcccccaaccaaagctgtggatcctatcgacgccccaaaagtcatcctc
agaacaagcctggaagtaaagcggggcgacgaaatagcgcttgacgcaaccatttctggc
tcaccttacccaacaatcacgtggataaaagatgaaaacgtcattgtcccagaggaaatt
aagaagcgagtagcacccccagttaggaggaagaagggcgaggctgaagaagaggagcca
tttaccctacctctgacagagcggttgagcatcaacaatagcaaacaaggagaatctcag
ctacgcgtccgtgattccctgcggcctgaccacggccagtacatgatcaaagttgagaat
gaccatggtgttgcgaaagctccttgcactgtgagcgtgttagacacgccaggaccgcca
atcaactttgtatttgaggatattagaaaggactctgtcctctgtaaatgggaaccaccc
ctggatgatggtggcagtgaaatcatcaactataccttggaaaagaaagacaagaccaaa
cccgactcagaatggattgttatcacatcgacactcagaaactgcaaatattcagtaaca
aagctgattgagggaaaagagtacctcttccgtgtaagagctgagaataggtttggacct
ggaccaccgtgtgtttcaaagccacttttagccaaagatccatttgaaccacctgatgcc
ccagataagcccattgtggatgatgtcaccagcaacagtatggtagtaaaatggaatgaa
ccgaaagataacggtagccccatcttgggttactggcttgaaaaacgtgaggtcaatagc
acacactggtctcgtgtcaacaaagcccttctcagttctttgaaaaccaaagtagatggc
ttactagaagggctcacctatgtcttccgagtctgtgctgaaaacgctgctggacctgga
aagttcagcccaccttcggatcctaaaacagctcgcgatccaatctctccgcccggaccg
cctgtcccaagagttgctgatacaagctctaccaccattgagctggagtgggagccccca
gctttcaatggcggcggcgaaattatgggctactttgtcgataagcagctggttggcaca
aatgagtggtcacgctgcacggagaagatggtcaaagtccgtcagttcactgtcaaagaa
atccgagagggtgcggactacaaacttcgagtgagcgctgtcaatgcggcaggcgaagga
ccgcctggggaaacagaacctgttaccgtggctgaaccacaagagcctccaactgtggaa
ctcgatgtttccgtcaagggcggaatacaaatcatggctgggaagactctcagaatccca
gccgtggtgactggccgtcccgtgcccacaaaagtgtggaccatagaagaaggggagcta
gacaaagagcgtgttgtaatagagaatgtcggaaccaaatccgaactcattatcaagaac
gcactgagaaaagaccacggcagatacgtgatcacggcaacaaacagctgtggttccaaa
tttgccgcagcccgggttgaagtgttcgatgtcccaggtccagttcttgacctcaaaccg
gttgtaacaaacagaaagatgtgtctgcttaattggtctgatccagcagacgatggcgga
agtgagatcacagggtttataattgaaaggaaagacgccaagatgcacacatggagacag
cccatcgagacggagagatccaagtgtgatatcacaggccttatagagggacaagagtac
aagttccgtgtcatcgccaagaacaagttcggctgtgggcctcctgttgaaataggaccg
attcttgcagttgatccactaggccctccgacatctcctgaaaggctcacatacacagaa
aggaccaaatccactatcacccttgactggaaggagccccgcagtgatggtggcagtccc
atccaaggatacatcattgaaaaacgtcgtcatgacaagcctgactttgaaagagttaac
aagcgactctgcccaaccacatcattcctggttgacaatctcgatgaacaccaaatgtat
gagttccgtgtcaaagccgtcaacgacattggtgaaagcgaaccatctctgcctcttaat
gtggtcatacaagatgatgaagtccctccaactattaagctgcgccttgctgttcgggga
gacacgatcaaagtgaaggcaggagagccggttaacatccctgcagatgtgacaggactc
cctatgcctaagattgaatggtccaagaatgaaaaggtgattgaaaagcccaccgatgca
ctgaacataaccaaggaagaagtctcccgaagtgaggcaaagactgaacttagcatcccc
aaagcagtccgagaggacaagggcacttacaccatcacagcttccaatcgtcttggctcc
gtgttccgcaacgttcacgtggaggtgtatgatcgcccatctccgcccagaaacctcgcc
gttactgacatcaaagctgagtcttgctatctgacatgggatgccccgctagacaacgga
ggcagtgagattacccactacatcattgacaaacgcgatgccagcaggaaaaagtctgaa
tgggaagaagtcactaacactgccgttgagagaagatatgggatctggaagctcatcccc
aatggtcagtacgagttccgagtgagggcagtgaacaaatacggaaccagtgatgaatgc
aaatcagacaaagtcgtcattcaagatccctaccgcctccctggacctcctggaaaacca
aaagtcttagagcggaccaaaggatctatgcttgtgagctggactcctcccttggacaac
ggagggtctccaattactggctattggctagagaagagagaggaaggcggtgcctactgg
tcacgtgttagccgagcaccaataaccaaagtgggactgaagggtgttgaattcagtgtt
ccacgcttgatcgaaggggtgaaataccagtttagagccatggcaataaatgctgcagga
attggccctcccagtgaaccatcagacccagctgttgcaggagatcccatatacccccct
gggccaccttcttgcccagaggttaaagataaaacaaaatcaagcatctcactagcatgg
aaacctccagccaaagacggtggcagcccaatcaaaggctacattgtggaaatgcaagag
gaaggtactacagactggaaaaaagtcaatgaacccgataaacttctcactgcctgtgaa
tgtgtggtgcctaatctgaaagaactcaggaagtacaggttcagagtgaaagctgtcaat
gaagctggagaatcggaaccaagtgacacaaccggagagatccctgccactgatatccaa
gaagttccagaggttttcattgacatcggcgcacaagactgcctgatctgcaaagctggc
tcacagatcagaatccctgctgtgatcaagggacgcccaacaccaaaatcatcttgggaa
tttgacggaaaggcaaagaaggcgatgaaggatggaattcacgatatacctgaagatgca
cagctggagactgccgaaaactcatctgtcatcgttatcccagagtgcactcgagctcac
tcaggcaaatacagcatcacggccaagaataaagcaggacagaaaactgccaactgcaga
gttaaagtcatggacgcaccaggcccccccaaggatttgaaggtcagtgacatcacaagg
ggtagttgccgcctctcgtggaagatgccagatgacgacggaggggacaggatcaaaggc
tatgtcattgagaagaagacgattgatgggaaagcctggaccaaagtcaatccaaactgt
ggaagcaccgccttcgtggtgccagatcttatctctgagcagcaatacttcttcagggtt
cgagcagaaaaccgttttggaattggcccacctgcagaaaccatccagaggaccactgcc
agagacccgatatatcctcccgatcttcctattaaactcaagattggtcttataacaaag
aacacagtgcatctgtcgtggaaacctccaaagaatgatgggggctctcctgttacccat
tatattgttgagtgcctggcatgggaccctactgggaagaagaaagaagcttggagacag
tgcaataggcgcgatgtggaagagttggagtttactgttgaagacctcgtagagggtggg
gaatacgaattcagagtcaaagctgtcaacgaggccggggtcagcaagccttcagccact
gttggtcctgtgactgtcaaagaccagacatgcccaccatcaattgagctaaaagaattc
atggaagttgaagaaggaactgatgttaacatcgtggccaagatcaaaggggtgccgttc
ccaacgctcacctggtttaaagctcctccaaagaagcctgatagcaaagagcccgttgtc
tatgacacccatgtcaacaaacaggtggtggacgacacttgcactttagtcatccctcag
tctcgccggagtgacactggcttatattctatcacagccgtaaacaacctggggacagca
tcaaaggagatgagactcaacgtccttggtcgtcctggcccccctgtgggacccataaag
tttgaatctatttcagcagatcagatgacattatcttggcttccacctaaagatgacggt
gggtctaagattacaaactacgtcattgagaaaagagaggctaacaggaagacatgggta
cgtgtctcgagcgagcctaaagaatgcatgtacacaatccccaagttgctcgaaggccat
gagtacgtcttccgaatcatggcgcagaataagtatggcattggagaaccactcgacagt
gaacccgagacggcccggaacctcttctctgtccctggagctccagataaaccaacagtg
agcagcgtcacccgcaactccatgactgtcaactgggaagaaccagaatacgatggtggc
tctcctgtgacaggctactggttagaaatgaaagacaccacctcaaagagatggaagaga
gttaaccgtgaccccatcaaagccatgactctgggcgtttcttacaaagtgactggcctt
attgaaggctcagactatcagttccgggtatatgcgatcaatgctgctggtgtgggtcca
gccagtctcccctcagatccagtgactgctagagatccagtcgctccccctggtcctcca
ttccccaaagtgacagactggacaaaatcatccgtggacttagaatggtctcctccgtta
aaagatggtggatccaaaataactggctacattgttgaatataaggaagaaggaaaagag
gaatgggaaaagggtaaagacaaagaagtgagagggacaaaactggttgtgactgggtta
aaagaaggagcattctataaattccgtgtgagagccgtcaacattgctggcgttggggaa
cctggagaagtcacagacattattgaaatgaaggacagaattgtgtcgcctgacctccag
cttgatgccagcgtcagagacagaatagtggtccatgctggaggggtgatccgaatcatc
gcctatgtgtctgggaagccacctcccactgtcacctggaacatgaatgaaagagccttg
cctcaagaggccaccattgagaccacagcaattagctcctccatggtcatcaagaactgc
cagagaagccatcaaggggtctactctcttctcgccaaaaacgaaggcggagaaagaaag
aagacaattattgttgatgtgttagatgtcccaggacctgttggaataccattcctctct
gacaatctaaccaatgactcctgcaaactgacatggttctctccagaagacgatggtggc
tctccaatcaccaattatgtcattcagaagcgggaagctgaccgcagagcatggacccct
gtcacatacacagtcactcgacaaaacgctaccgtacagggtcttattcaaggaaagtcc
tacttcttccgaattgcagctgagaacagtattggcatgggcccgttcgttgagacacca
aatgcccttgtcatcagagacccaataactgtgccagagagaccagaagacctggaagtc
aaagaagtcaccaaaaatactgtgactttgacttggaatcctcccaagtatgatggcgga
tcagaaattattaactacgtcctcgaaagccgactcattggtactgagaagttccacaaa
gttacaaatgacaatctgcttagcaggaaatacactgttaaaggtttaaaagaaggcgat
acgtatgagtaccgcgtcagtgccgtcaatattgtcggacaaggcaaaccgtcattctgc
accaagcccatcacttgcaaggatgagctagctccccctacgcttgacctcgacttcaga
gacaagcttacagtccgggttggtgaagctttcgccctcactggccgttactcaggcaaa
ccaaagcctaaggttgattggtttaaagatgaagctgatgtgctggaagatgaccgaact
cacataaagaccactcccacaacactcgctcttgagaagacaaaggccaaacgctccgat
tctgggagatactgtgtagttgtggagaacagtacaggctccaggaaaggtttctgtcag
gtcaacgttgtggatcgtcctggaccaccggtaggacctgtcgtttttgatgaggtgacc
aaagaatacatggttatttcttggaagccacctctagatgatggaggaagtgaaattacc
aattatattattgagaagaaggagctgggtaaagacatctggatgcctgtgacatctgcc
agtgccaaaacaacatgcaaggtccctaaactgctcgaaggaaaagattacatcttccgg
atccatgctgaaaatctctatggaatcagtgaccctctggtgtcggactcaatgaaggcc
agagatcgcttcagagttcctgatgcacctgagcagccagttgtcacagaggtcaccaaa
gactctgcattagtaacctggaacaagccaaatgatggagggaagcccatcacaaactac
atcctggaaaagagggaaactatgtctaaacgatgggttagagttaccaaagagcctatc
catccatacactaagtatcgagttcccgatcttctagaaggatgccaatatgaattccgt
gtttctgctgaaaatgaaattggtattggagacccaagtccaccatccaaaccagtcttt
gctagagacccgattgctaaaccaagtccacctattaatcctgaggcaatagatacaaca
tgcaattcagttgatctaacttggcagccaccccgtcatgatggtgggagcaagatcctg
ggatatatcgtggagtaccagaaagttggagatgaagagtggagacgagccaatcacact
cctgaatcatgccctgaaactaaatataaagtcactggtctcagagatggccagacctat
aagttccgagtgctggcagtcaacgaggctggtgaatcagacccagcccatgttcctgaa
ccagttctagtaaaggaccgacttgaacctcctgagctgatccttgatgctaacatggca
agagaacaacacattaaagttggtgatactctgagacttagtgccatcatcaaaggcgtg
ccattcccaaaagtgacctggaaaaaagaagacagagaggctccaacaaaagcacagatt
gatgttactccagttggaagcaagcttgagatccgtaatgctgcccacgaagatggtgga
atttattccctaactgtggagaatccagcaggttcaaagacagtctcagtaaaagtattg
gtcttagataaacctgggccacctagagatctggaagtcagtgaaattaggaaagactct
tgttaccttacatggaaggaaccattggatgatggtggttctgttgtaaccaattatgtg
gttgagaggaaagatgttgccactgcccaatggtcccctctttcaactacatcaaagaag
aagagccacatggctaaacatctgaatgaaggcaatcagtaccttttccgtgtagctgct
gagaaccaatatggacgtggtccttttgtagaaacacctaagcccatcaaggctctggat
cctctccatcccccaggaccgcccaaggacctacaccatgtagacgtcgacaagactgaa
gtctctcttgtttggaataagcccgatcgtgatggtggttctccaatcacgggatactta
gtggaatatcaagaagaaggtgccaaagactggatcaagttcaagactgtgaaaaactta
gagtgtgttgttacaggcttacaacaagggaagacctatagattccgtgtaaaagctgaa
aatatcataggtcttggactccctgatacaactatcccaatagaatgtcaagagaaacta
gagcctccatctgttgaattagatgtgaagttaattgaagggctcgtggtgaaggctggt
accacagtaagattccctgccatcataagaggtgtacctgttcctactgcaaaatgggca
accgatgggactgagattacaacagatgaccactacacagttgagaccgacagcttctca
tcagtgctgaccattaagaattgcttaaggaaggatactggggaatatcaactcacagtt
tccaatgcagcgggtaccaaaacagtagctgtccatcttactgttcttgatgtacccggt
ccaccaacaggtcctattaatattctggatgttacccctgaatacatgactatctcatgg
caaccacctaaggatgatggagggagcccagtgataaattacattgttgagaaacaagat
acaaggaaaggtacatggggtgtcgtctccgcaggaagcagtaagctgaagctgaaggtc
ccacatctccaaaaaggctgtgaatacgttttcagagtcaaagcagagaacaaaatgggt
gtcggtcctccccttgactccatacctactgttgctaaacacaagttcagtcctccatct
cctcctggtaaaccagtggtaactgacattactgagaatgctgccacagtgtcttggacc
ctgccgaagtctgatggtggcagtcccataactggctattatgtagaacgccgggaaata
actggcaagtgggtgagggtcaacaaaacacctattgctgacctgaagttcagggtgact
ggactctatgagggaaatacatatgaatttagagtgtttgctgaaaatcttgctggttta
agcaatccatccccaagttctgacccaatcaaagcttgccggcccatcaaaccaccaggg
ccacctataaatcctaaactgaaagacaagaccaaagaatctgctgacttggtgtggaca
aagcccctcagtgatggcggcagccccattcttggatatgtagtagagtgtcagaaacct
ggcacaacacagtgggataggattaataaagatgaacttatcaggcagtgtgccttcagg
gtacctgggctgattgaaggaaacgagtacagatttcgcataagagcagctaatattgtg
ggtgagggagagccaagagagctcgcagaatctgtgattgcaaaagacatccttcatcct
ccagaagtagaacttgacgttacatgccgtgatgtcattaccgtccgggtgggtcaaact
atccgcattcttgctcgagtcaaaggcagacctgagccagacataacttggtctaaggag
gggaaagtactggtcaaagacaagcgagttgacctaattcatgatctacctcgtgtcgag
ttacaaattaaagaagctgtcagagctgaccacggcaagtatattatctctgctaaaaac
agcagtgggcatgcccaagggtcagccattgttaatgtccttgacagacctggaccttgc
cagaatctgaaggttagcaatgtaaccaaggaaaactgcacaatttcttgggagaaccca
ctagataatggtggctcagagattacaaatttcatagtggaatatcgtaagccaaatcag
aaaggctggtcaattgttgcctcagatgtcaccaagagactgatcaaagccaacctgttg
gccaataatgaatactatttccgtgtttgtgcagagaataaagtaggtgttgggccaacc
attgaaacaaaaactccaatcttggctatcaaccctattgacaggcctggtgagcctgaa
aacctgcatattgcagataaaggaaagacatttgtctatctaaagtggcgacggcctgat
tatgatggtggtagcccgaatctatcataccatgtggaaaggagattgaagggctctgca
gactgggaaagagtgcataaaggtagcattaaggaaacccactacatggttgacaagtgt
gttgaaaaccagatttatgagttcagagtacaaactaagaatgaaggtggagaaagtgac
tgggtaaggacagaggaagttgttgtgaaggaagatttacagaagccagtacttgatcta
aaattaagtggggtgctaactgtcaaagcaggggacaccattagactcgaggcaggtgtg
agaggcaaaccattcccagaggttgcctggaccaaagacaaagatgctacagatttaaca
agatcaccaagggtcaagattgataccagtgctgagtcatcgaaattctcccttaccaaa
gcgaagcgaagtgatggcggtaaatatgtagtcacagcaactaacccagctggcagtttt
gtggcctatgcgactgtcaatgttttggataagcctggtcccgtaagaaacctgaaaatc
gcggatgtgtccagtgataggtgtactatccgctgggatccaccggaagacgacggcggc
tgtgaaatccaaaattatattctagagaaatgcgagagcaagagaatggtctggtctacc
tattccgctaatgtcctgacaccaggtgctacagtgactcgtctcatagaaggaaatgaa
tatattttcagagtccgtgcagaaaacaaaataggcacagggcctccaacagaaagtaaa
ccagtcattgcaaagaccaagtatgacagacctggtcgccctgatcctccagaagtcact
aaagtgagcaaagaagagatgactgtggtttggaatgcccccgaatatgatggcgggaag
tctatcacaggatactatttagagaaaaaagaaaagcacgcagtccgctgggtccctgtt
aacaagagcgccatccccgagcgccgtctgaaagtacagaatctcctcccagggcacgag
taccagttccgtgtcaaggcggagaatgaggttggcattggagagccaagcctaccatca
agaccagtggtggcaaaagatcccatagaaccacctggcccacccaccaatttcaaagtg
gttgatacaaccaaaaattccatcactctcgcctggggaaaaccagtctatgatggtggt
gccccgatcatcggatatgtcgtagaaatgagacccaaaatagcagacgcatcgcccgac
gagggctggaaaaggtgcaatgctgcggctcaactcgttcgcatggaattcacagtcacc
agtttggacgagaaccaggagtatgagttcagggtgtgtgcccagaatcaggttggcatt
gggcgccctgcagaactaaaggaagccatcaggcctaaggaaatcctagagcctccagag
attgacttggatgccagcatgagaaaattggtcgtggtgagagcaggctgccctattcga
ctatttgccatagtgagaggacgccctgcccccaaagtcacatggcgcaaagtgggtatt
gataatgtggtcagaaaaggacaagtcgatctagtggacactatggccttccttgtcatt
cccaattctacccgtgatgactctggaaaatactccctgacccttgtgaacccggcagga
gaaaaggctgttttcgtgaatgtcaaagtactagatactcctggacctgtgtctgactta
aaagtttcggatgtcactaaaacctcgtgccacgtgtcctgggcacctcctgagaatgat
ggtgggagcccagtgacacattatattgtggagaagcgtgaggcagagagaaaaacatgg
tcaacagttacccctgaagtgaagaaaacaagcttcaatgtaaccaaccttgtccctggg
aatgaatacttcttccgagtaaccgctgtcaatgaatatggccctggtgtcccaacggat
gtccccaaacctgtgcttgcctcagaccctctcagcgagccagatcctccaagaaaagtt
gaggtgaccgaaatgacaaagaacagcgctacgctggcctggttacctccattgcgtgac
ggaggcgctaaaatcgacggctacattattagttacagagaagaagaccaacctgcagat
cgctggacagagtactcagtggtcaaagacctcagccttattatcactggcctaaaggaa
ggaaagaaatataaatttagagttgcggctagaaatgctgttggagtcagcatgccgaga
gaagccgaaggtgtctacgaggccaaagagcagctgttgccaccaaagatcctcatgcct
gagcaaatcaccattaaagctgggaagaagctccgggtcgaagctcatgtgtatggaaag
cctaaccccatctgtaaatggaagaagggagaagatgacgtcgttacgtccagccacctg
gccatccacaaggcagacagttcctcggttctgatcataaaggatgtcactagaaaagac
agtggctactatagcctcacggcagagaatagctccgggacagacactcagaagatcaaa
gtgacagtcatgggtctagaatattcattccgaatctatgccctaaacaaagctggatcc
agtccacctagcaaaccaacggagtatgtgactgctaggatgccagttgatccaccaggg
aaacctgaagttgttgacgtcaccaagaatagcgcatcgcttatctgggcccgtccaaag
cacgatggaggcagcaaaatcatcggctattttgtagaagcttgcaaacttcctggtgat
aaatgggttcggtgcaataccacacctcaccagatcccgctggaagagtacacagctact
gggttagaagagaatgctcagtatcaattcagagcaattgccaagactgctgtgaacatt
agccagccttctgagccttccgacccagtgaccattcttgcagaaaatgttcctcctagg
atagaactcagtgtcgagatgaagtctttgcttaccgtgaaagctgggactaacgtctgc
ttggatgcgactgtcttcggtaaaccgatgcccacagtttcttggaagaaagacagcaca
ccaataaaacaaaccgaaggcgtaaagatggcgatgaagcggaacttgtgtaccttggag
ctattcagtgtgaaccggaaggactcaggagactataccattactgccgaaaactccagc
ggttccaaatcagccaccattaagcttaaagtactagataaaccaggtcctccagcatct
gtgaaaatcaacaagatgtatgcagaccgtgcaatgctgtcctgggagcctcccctggaa
gatggaggttcagaaatcaccaactacatcgttgacaagcgagaaacgagcaggcccaac
tgggctcaggtctctgctactgtgcccatcaccagctgcactgtggagaaacttatagag
ggccatgaataccagttccgtatctgtgccgaaaacaaatatggagtcggcgatcccatc
ttcactgagccagtaattgccaaaaacccatatgacccgcctggacgctgtgaccctcct
gtcattagcaacatcactaaagatcacatgacggtcagctggaaagcgcccgctgatgat
ggcggctcacccatcactggatacttggttgagaagcgggaaacccaggcagttaactgg
accaaagtcaacagaaaaccggttatagaaagaacgttgaaagcgacaggtctccaggaa
ggcactgagtatgagttccgagttactgctataaacaaagccggacctggcaagcccagt
gatgcgtccaaagccgtgtatgcgcaagacccactgtatcctcctggcccaccggctttc
cctaaagtctatgataccacccgtagttctgtgagtctatcgtggggcaagccagccttc
gatggtggcagccccatcattggttatcttgtggaagtaaagcgagctgattctgatcac
tgggtgaggtgcaatttaccagagaagctacagaaaacccgcttcgaggtgacaggtctg
atggaaaatacggagtatcagttccgagtgtatgccgttaataagatcgggtacagcgac
cccagtgatgtgccagataaacactgtcccaaagacatcctaattccgcctgagggagaa
cttgatgctgaactaaggaaaacactgattttacgtgctggagttacaatgagactctac
gtgccagtaaaaggacgcccacctccaaagattacttggtctaaacctaacgtcaatcta
agagaaaggattggcctggacataaagtcgacagactttgacaccttcctgcgctgcgaa
aatgtgaacaaatacgatgcaggaaagtacatcttaaccttggagaacagctgtggcaaa
aaggagtacaccattgtagtgaaagtgctcgacacccctgggccacctgtcaatgtgact
gttaaggaaatatccaaggactctgcatatattacctgggatcctcctattattgatggc
gggagccctatcataaactacgtggttgaaaaacgggatgcagagaggaagtcctggtcg
acagtgacaactgagtgccccaaaacgagcttcagagtctctaacttggaggaggggaaa
tcctacttcttcagagtgtttgctgaaaacgagtatggcatcggggatccgggtgagaca
cgtgatgctgtcaaagcctctgaaactcctggacctgtggttgacctgaaagtgctggca
gtaaccaagtcatcttgtaccattggctggaaaaagcctcgcagtgatggcggaagcaga
atcacgggctatgtggtggatttcctgacggaagagaataagtggcaacgggtcatgaaa
tcattgagcctacagtactccacaaaagatctgaaggaggggaaggagtataccttcaga
gtgagtgcagagaacgaaaatggcgaaggaaccccaagtgaaatcatggttgtggccaag
gatgatgttgtggctcccgatcttgacttaaaggatcttcctgatttgtgctacttggct
aaagaaaacagcaacttccgtctcaagatccccataaaaggcaaaccagcaccgtcagta
tcttggaagaagggagaagatcctctagcaacagacacaagagtcagtgtcgaatcaact
gcagttaatacaacccttgtagtatatgattgccaaaaatccgatgctggaaaatacaca
atcacactcaagaatgttgctggcaccaaggaaggaactctctccataaaggttgttggc
aaacctggcatccccaccgggccaatcaaatttgatgaagtcacggcagaagccatgacc
ttgaagtggggtcctccaaaggacgatggaggttctgaaatcaccaactatgtactagag
aagagagactctgtgaataacaagtgggtgacatgtgcttcggctgtccagaaaaccacc
ttcagagtaaccagacttcacgagggcatagagtacaccttcagggtcagcgctgaaaat
aaatatggcgtaggggaaggcctgaagtcagagccaattgttgccaaacatccatttgat
gtgcctgatgctcccccacctcccaatattgtggatgtcagacatgattcagtgtctcta
acatggactgaccccaaaaagactggtggctcaccaattacagggtatcatattgaattc
aaggaaagaaacagccttctgtggaagagagctaacaagactcctataaggatgaaagac
ttcaaagtgacaggattaacagaaggtcttgaatatgaattccgagtcatggctatcaat
ctagctggagtgggcaagccaagcctgccgtcagagccagttgtggctcttgatccaatt
gatcctcctggaaaacctgaggttattagtgtaacaaggaattcagtgactctcatctgg
acagaacccaaatatgatggtggccataaattgacagggtacatagtggagaagcgggat
ctaccctctaagtcttggatgaaagccaaccatgttaatgtcccagactgtgcctttacc
gtaactgaccttgttgaaggtggaaaatatgaattcagaatcagagccaagaatacagca
ggtgctatcagcgctccgtcggagagcacaggaaccattatttgcaaggatgaatatgag
gcaccaaccattgtccttgatccaacgattaaagatggactaacagtcaaggcaggggat
agcattgttttaagtgccattagcattcttggcaaacctcttcctaagtcaagttggtcg
aaggcaggaaaagatatcagaccatcagacatagctcaaataacttcaacccctacatct
tctatgctgacagttaagtatgccacgagaaaggatgccggggagtacaccatcactgct
accaatcctttcggcacaaaggaagaacatgtgaaggtatcagtcctcgatgtacctggt
cccccaggtcccattgaaatcagtaatgtttctgccgaaaaagcaacacttacctggaca
cctcccttagaagatgggggctcaccaattaaagcttatgttcttgagaagagagaaacc
agtcgacttttgtggacagtggtgtctgaagatattcaggcttgcaggcatgtggtaacc
aaactcatccaaggaaacgaatacctcttccgtgtgtcagcagtaaaccattacggcaaa
ggagaacccgttcagtctgagcctgtcaaaatggtggacagatttggtccccctggccct
cctggaaaaccagagatctcaaacgtcaccaagaacacggccaccgtcagctggaagagg
ccaattgatgatggtggcagcgagatcacaggataccatgtagaaaggagagaaaagaaa
ggcctgcggtgggtgagagccaccaaaacaccagtttccgatctcaggtgcaaagtaact
ggactacaggaaggaaatacctatgaattccgcgtcagtgcagaaaacagagcagggatc
ggcccacccagtgacgcctcgaatcctgttctgatgaaagacgttgcatatcctccagga
ccgccttcaaatgcacatgtcaccgataccaccaagaaatcagcttctttagcatggggc
aagcctcattatgatggtggtcttgagatcactggctacgtggtagagcatcaaaaagta
ggagacgatgcctggataaaagatacaacgggaacggccctcagaatcactcagtttgtg
gttcctgaccttcagactaaggaaaaatacaattttagaattagcgccgtcaacgatgca
ggtgttggggagccagcagtgattccaaatgttgaaattgttgagaaggaaacagctcct
gattttgagctagatgccgagctgcgaagaacactggtggttagggcagggctcagtatt
aggattttcgtgccaattaaaggtcgtcctgcacctgaagtgacatggaccaaagataat
atcaacctgaagcacagagccaacatcgaaaatacagagtcatttactcttctcattatc
ccagaatgtaacagatatgacactggtaaattcgtgatgaccatcgaaaacccagctggg
aagaaaagcggcttcgttaacgtcagagtcctagacaccccaggccctgtccttaaccta
aggccaacagacatcacaaaggacagtgtcaccctacactgggacctacctctgatagat
gggggctcacgtataacaaattatattgtggagaaacgtgaagccaccaggaaatcatac
tccacagtcaccactaagtgccataaatgtacatataaagtgaccggcttgacggaaggg
tgtgaatacttcttcagagtgatggcagaaaatgaatatgggattggcgagccaacagaa
accacagagcctgtaagagcctccgaagcaccattacccccagatagcctgaacattatg
gacattaccaagaacacagtcagcctggcgtggcccaaaccaaggcatgacggtggtagc
aagatcactggttatgtgattgaagcccagaggaaagggtctgaccagtggacccacatc
tcaacggtgaaagggttagaatgtgtggtgaggaacctaacagaaggagaggaatatacc
ttccaagtgatggcggtaaacagtgcaggcagaagtgcccctagagagagcagacctgtc
attgtcaaagagcagacaatgctcccagagctggatctccgtggcatctatcagaagcta
gtcattgccagagctggtgacaacatcaaagttgaaattccagtacttggtcgacccaag
cccacagtcacatggaaaaaaggagaccaaatccttaagcagacacagagagttaatgtt
gaaaatacagcaacctcaaccatcttaaatatcaatgagtgtgttagaagtgacagcgga
gcctatccattaacagcaaagaacactgtaggagaggttggtgatgtcataaccattcaa
gtccatgatatcccgggaccacctacaggaccaatcaaattcgatgaggtttcatctgac
tttgtaaccttctcttgggagcctcccgagaatgatggaggtgtaccaataagcaactat
gtagtagaaatgagacagacagacagcactacgtgggtggagttagcaacaaccgttata
cgcaccacctacaaagcaacccgtctgacgacaggagtggagtatcaattccgtgtaaag
gctcaaaacagatacggagttgggcctggcattacatctgcatctgtagttgctaactat
ccatttaaggtgcctgggcctcctggtacccctcaggttactgcagtcaccaaagactcc
atgacaattagctggcacgagccactttctgatggtggaagccccattttaggatatcac
attgaaaggaaagaacggaatggcattctctggcagaccgtgagcaaagcattagtacca
ggcaacattttcaaatcaactggacttactgatggcattgcttatgaattccgagtaatt
gcagaaaacatggcaggcaagagcaagcctagcaaaccatctgaaccaacatttgctttg
gaccccattgacccacccgggaaaccagtacctctaaacattacaagacacacagtggca
ctgaagtgggctaagcctgaatacactggaggctttaaaattactagttacgtggttgag
aagagggaccttcctaatggacggtggctgaaggccaacttcagcaacattttggagaac
gaatttacagtcagtggcctaaccgaagatgctgcctatgagttccgtgtgattgccaaa
aatgccgccggtgccatcagtccaccatctgagccgtcagatgccatcacgtgccgggat
gaccttgaggcaccaagaataatggtggatgttaaatttaaggataccatcacattaaaa
gctggagaagcattcaagctggaagctgatgtttcaggtcgcccacctccgacgatggaa
tgggctaaagacggaaaggagcttgaaggcacagggaaactagaaataaaaatcgcagac
ttctccactcatctgataaacaaggattcctcaagaacggacagtggggcttacatcctg
acagcaaccaatcctggtggctttgccaaacacattttcaatgtcaaagttctcgataga
ccaggcccacctgagggacctttggctgtgtctgatgtgacatcagagaagtgtgtgttg
tcgtggttgcctccgctggatgatggaggtgccaaaatcgatcattacatcgtacagaaa
cgtgaaaccagcaggttggcgtggacaaatgttgccacagaagtccaagtaacaaaactg
aaggtcactaagctcctgaaaggcaatgaatatatattccgtgtcatggctgtaaataaa
tatggggttggagagccacttgaatcagagcctgtgcttgcagtggatccatatggacca
cctgatccacccaagaacccagaagttacaaccatcaccaaagactccatggttgtctgc
tgggggcatcctgactctgatggtggaagtgagattatcaactacattgtggagcggcgt
gataaagctggccaacgctgggtaaaatgcaacaaaaaagcccttactgacttaagattt
aaagtatctgggctgacagaaggacatgaatatgagttcagaattatggcagaaaatgca
gctggagtcagtgctccaagtgctaccagcccattttataaagcttgtgacagcgtgttt
aaacctggcccgccgggtaacccgcgtgtccttgatacaagcaggtcatccatttcaatt
gcatggaataaacctatctatgatggagggtcagaaatcactgggtatatggttgagatt
gccctgcctgaagaagatgaatggcaagttgtcactccaccagctgggctcaaggcaact
tcctataccatcaccaacctcatagagaatcaggaatataaaatccgcatctatgccatg
aattctgagggacttggggaacctgccctcgttcctggaactccaaaggcagaggaaaga
atgcttcctccagagatagaactggacgctgacttacgcaaagttgttactataagagcc
tgctgcaccttgagactctttgtccctatcaaagggagaccagcaccggaagtcaagtgg
gcccgagagcatggagaatctttggacaaggctagcattgaatccacaagttcttacacc
ctgctcgttgttggaaatgttaacagattcgatagtggcaagtacatcctaactgtagaa
aacagctcaggaagcaagtctgcatttgtcaatgttagagtgttagatacaccaggccct
ccacagaatctaaagataaaggaggtcacaaagacatctgtcacattgacgtgggagcct
cctctccttgacggaggctcaaaaataaagaactatattgttgaaaagcgagaatccaca
agaaaggcatattcaactgtggcaacaaattgccacaagacttcctggaagatagaccag
cttcaagaaggatgtagctactatttccgggtcctcgccgaaaatgaatatggaatcgga
ctgcccgctgagacagcagagtctgtgaaggcatcagaacgacctcttcctccaggaaaa
ataaccttgatggatgtcacaagaaacagcgtgtctctctcttgggagaagccggaacat
gatggaggcagccgaattctaggctacatcgtagagatgcagagcaaaggcagtgataaa
tgggccacatgtgccacagtgaaagtcacagaagccaccatcaccgggctgatccagggt
gaggaatactctttccgtgtttcagctcagaatgaaaagggcatcagtgacccgagacaa
ctgagtgtgccagtaattgctaaagaccttgtgataccaccagccttcaaactcctcttc
aatacattcactgtactggcaggggaagacctgaaaatcgatgtaccattcatcggacgc
cctacaccaactgtcacttggcataaggatgacgtaccgctgaagcaaacaactagagta
aatgcagagagcacagagaacaattctctactgacaataaaggaagcctgccgtgaagat
gtcggacattacacagttaaactgactaactcagcaggcgaagccaccgaaacccttaat
gttattgtccttgacaagccagggcctccaactggaccagttaaaatggatgaagtgaca
gcagacagtgttactctttcctgggaaccaccaaagtatgatggcggaagctccatcaat
aattacattgtagagaaacgggacacgtccacaactgcctggcaaatcgtgtcagctaca
gtcgcaagaaccaccataaaggccagcagactaaagactggttgtgaataccagttcaga
attgcagcggaaaacagatatgggaagagtacctacctcaattcagagcctgttattgcc
cagtacccattcaaagtgccaggtccccctggcacgccattcgtcactcttgcctccaaa
gacagcatggaggtacaatggcatgagccagtcagtgatggtgggagcagagtcattggc
taccatctagagcgcaaggaaagaaatagcatcctctgggtcaagctgaataaaacacct
attccacaaaccaagttcaagacgactggccttgaagaaggcattgaatatgaattcaga
gtgtctgcagagaacatcgttggcatcggtaagccaagtaagccatcagaatgttatgct
gctcacgatccatgtgacccaccaggacgtccagaggcaatcatcgtcacaaggaactct
gtgactcttcagtggaagaaacccacctacgatggtgggagcaagatcaccggttatgtt
gttgagaagaaagaattacctgacggccgctggatgaaagccagttttacaaatatcatt
gacacccagtttgaggtaactggcctaattgaagatcatagatatgagttccgagttata
gctcgaaatgccgcaggagtgttcagcgagccctccgaaagcaccggggcaataacagcc
agggatgaggtagagccacccagaataagcatggaccccaaatacaaggacacggttgtg
gttcaggctggcgagtcattcaagatcgatgcagatatatacggcaaaccaataccaacc
actcagtgggtaaagggtgaccaggagctttcaagcacagctcggttagaaattaagacc
accgacttcgccaccagtctcagtgtcaaagacgcagtacgtgtggacagtggcaattat
atcctgaaggccaaaaatgttgcaggggagaaatcggttactgtcaatgtcaaagttctt
gatagaccagggccacctgagggacctgttgctatatcaggagttacagcagaaaaatgt
atgctagcctggaaacccccgcttcaggatggtggcagcgatatcataaattacattgtg
gagaggcgagagaccagccgcctcgtctggactctggtggatgccaatgtgcaaactctc
agctgtaaagttacgaagcttctcgaaggcaacgaatatattttccggataatggctgtg
aacaaatacggtgttggggagcctcttgaatctgagccattgattgccaagaatccattt
gtagtcccagatgcacccaaggctccagaagttacagctgtgaccaaagactcaatgatt
gttgtatgggaaagaccagcatctgatggtggcagtgagattctaggatatgttctagaa
aaacgggacaaagaaggcataaggtggacaagatgccacaagcgtctaattggagagctg
cgtctgagagtgactggactcttagaaaatcacaattatgaattcagagtctctgctgaa
aatgctgctggacttagtgaaccaagccccccttctgcttaccaaaaggcttgtgacccc
atttataaaccaggccctccaaacaaccccaaagtcatggatgttaccagatcttcggtt
ttcctttcttggaccaaacccatttatgatggtggctgtgaaatccaaggatacatcgtg
gaaaaatgtgacgtgagtgttggtgaatggacaatgtgtacgccaccaactgggatcaac
aagacaaatctagaagtcgagaagttgttggaaaagcatgaatacaacttccggatctgt
gccattaataaggctggagtcggggagcatgctgatgtccctgggcctgtaatggttgaa
gaaaaacttgaagcgccagatatagatcttgaccttgaactaaggaaagttattaatata
agggcaggtggctccttaaggttgtttgttcctataaaaggccggcctacaccagaagtc
aagtgggggaaggtagatggtgaaatccgggacgcagctataatcgatgtcactagcagc
ttcacctctcttgttcttgacaatgtcaatcgatatgatagtggaaaatacactctcaca
ttagaaaacagcagtggaacaaaatctgcctttgtgactgtgagagtcctggacacacca
agcccacccgttaacctaaaagtcacagaaatcaccaaggactcggtatcaattacatgg
gaacctcctttgttggatggaggatcaaaaattaaaaattacattgttgagaaacgagaa
gccacaagaaaatcatatgctgccgttgtaacgaactgccataagaattcttggaaaatt
gatcagctccaagaagggtgcagttactacttcagagttactgctgagaacgaatatggt
attggcctgcctgcccgcactgcagatccgatcaaggttgcagaagtcccacaacctcca
ggaaaaataaccgtggacgatgtcaccagaaacagtgtctctctgagttggacaaagcct
gaacacgatggcggcagtaaaatcattcagtatattgtagaaatgcaagctaaaaacacc
gataagtggtcagagtgtgctaggatcattgctgtaaatgagacaggaagaggagtgacc
ccagaccgcgttgcatgtgtccagatcattgggctattgcgcatatcagtgatcataggg
tcaggtgttcgagacggcggcgatgagcgagtgatttttcagcttcggttagatcagcgt
gtgtactcgctagtgtgccttgctgaacatcctacaccaagagctctgacgcctctcacg
gttgacgcgttcgctatttatgcgtaccacgggatgtctgttctcctcggcgctctgaat
agttatatttcttatgatatatgtacagtgtatgagtatgaccgagatcaataa

DBGET integrated database retrieval system