KEGG   Rattus norvegicus (rat): 84027Help
Entry
84027             CDS       T01003                                 

Gene name
Gsk3b
Definition
(RefSeq) glycogen synthase kinase 3 beta (EC:2.7.11.1 2.7.11.26)
  KO
K03083  
glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
rno  Rattus norvegicus (rat)
Pathway
EGFR tyrosine kinase inhibitor resistance
ErbB signaling pathway
Chemokine signaling pathway
Cell cycle
mTOR signaling pathway
PI3K-Akt signaling pathway
Wnt signaling pathway
Hedgehog signaling pathway
Axon guidance
Hippo signaling pathway
Focal adhesion
Signaling pathways regulating pluripotency of stem cells
T cell receptor signaling pathway
B cell receptor signaling pathway
Neurotrophin signaling pathway
Dopaminergic synapse
Insulin signaling pathway
Melanogenesis
Prolactin signaling pathway
Thyroid hormone signaling pathway
Insulin resistance
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Hepatitis C
Measles
Influenza A
HTLV-I infection
Epstein-Barr virus infection
Pathways in cancer
Colorectal cancer
Endometrial cancer
Prostate cancer
Basal cell carcinoma
Module
Wnt signaling
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    84027 (Gsk3b)
   04310 Wnt signaling pathway
    84027 (Gsk3b)
   04340 Hedgehog signaling pathway
    84027 (Gsk3b)
   04390 Hippo signaling pathway
    84027 (Gsk3b)
   04151 PI3K-Akt signaling pathway
    84027 (Gsk3b)
   04150 mTOR signaling pathway
    84027 (Gsk3b)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    84027 (Gsk3b)
  Cellular commiunity
   04510 Focal adhesion
    84027 (Gsk3b)
   04550 Signaling pathways regulating pluripotency of stem cells
    84027 (Gsk3b)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    84027 (Gsk3b)
   04662 B cell receptor signaling pathway
    84027 (Gsk3b)
   04062 Chemokine signaling pathway
    84027 (Gsk3b)
  Endocrine system
   04910 Insulin signaling pathway
    84027 (Gsk3b)
   04917 Prolactin signaling pathway
    84027 (Gsk3b)
   04919 Thyroid hormone signaling pathway
    84027 (Gsk3b)
   04916 Melanogenesis
    84027 (Gsk3b)
  Nervous system
   04728 Dopaminergic synapse
    84027 (Gsk3b)
   04722 Neurotrophin signaling pathway
    84027 (Gsk3b)
  Development
   04360 Axon guidance
    84027 (Gsk3b)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    84027 (Gsk3b)
   05210 Colorectal cancer
    84027 (Gsk3b)
   05217 Basal cell carcinoma
    84027 (Gsk3b)
   05215 Prostate cancer
    84027 (Gsk3b)
   05213 Endometrial cancer
    84027 (Gsk3b)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    84027 (Gsk3b)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    84027 (Gsk3b)
   04931 Insulin resistance
    84027 (Gsk3b)
  Infectious diseases
   05166 HTLV-I infection
    84027 (Gsk3b)
   05162 Measles
    84027 (Gsk3b)
   05164 Influenza A
    84027 (Gsk3b)
   05160 Hepatitis C
    84027 (Gsk3b)
   05169 Epstein-Barr virus infection
    84027 (Gsk3b)
  Antineoplastic resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    84027 (Gsk3b)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     84027 (Gsk3b)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: CMGC group
  GSK family [OT]
   84027 (Gsk3b)
Chromosome [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    84027 (Gsk3b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
11q21
AA seq 420 aa AA seqDB search
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALF
NFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNNAASASASNST
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtcggggcgaccgagaaccacctcctttgcggagagctgcaagccagtgcagcagcct
tcagcttttggtagcatgaaagttagcagagataaagatggcagcaaggtaaccacagtg
gtggcaactcctggacagggtcctgacaggccacaggaagtcagttacacagacactaaa
gtcattggaaatgggtcatttggtgtggtatatcaagccaaactttgtgactcaggagaa
ctggtggccatcaagaaagttcttcaggacaagcgatttaagaaccgagagctccagatc
atgagaaagctagatcactgtaacatagtccgattgcggtatttcttctactcgagtggc
gagaagaaagatgaggtctaccttaacctggtgctggactatgttccggaaacagtgtac
agagtcgccagacactatagtcgagccaagcagacactccctgtgatctatgtcaagttg
tatatgtaccagctgttcagaagtctagcctatatccattcctttgggatctgccatcga
gacattaaaccacagaacctcttgctggatcctgatacagctgtattaaaactctgcgac
tttggaagtgcaaagcagctggtccgaggagagcccaatgtttcatatatctgttctcgg
tactacagggcaccagagctgatctttggagccaccgattacacgtctagtatagatgta
tggtctgcaggctgtgtgttggctgaattgttgctaggacaaccaatatttcctggggac
agtggtgtggatcagttggtggaaataataaaggtcctaggaacaccaacaagggagcaa
attagagaaatgaacccaaattatacagaattcaaattcccccaaatcaaggcacatcct
tggacgaaggtctttcggccccgaactccaccagaggcaatcgcactgtgtagccgtctc
ctggagtacacgccgaccgcccggctaacaccactggaagcttgtgcacattcatttttt
gatgaattacgggacccaaatgtcaaactaccaaatgggcgagacacacctgccctcttc
aactttaccactcaagaactgtcaagtaacccacctctggccaccatccttatccctcct
cacgctcggattcaggcagctgcttcaccgcctgcaaacgccacagcagcctcagatact
aatgctggagaccgtggacagaccaataacgccgcttctgcatcagcctccaactctacc
tga

DBGET integrated database retrieval system