KEGG   Rattus norvegicus (rat): 84389Help
Entry
84389             CDS       T01003                                 

Gene name
Ccnh
Definition
cyclin H
Orthology
K06634  
cyclin H
Organism
rno  Rattus norvegicus (rat)
Pathway
Basal transcription factors
Nucleotide excision repair
Cell cycle
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:rno00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    84389 (Ccnh)
  Replication and repair
   03420 Nucleotide excision repair
    84389 (Ccnh)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    84389 (Ccnh)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     84389 (Ccnh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
2q12-q14
AA seq 323 aa AA seqDB search
MYHNSSQKRHWTFASEEQLARLRADANRKFKCKAVANGKVLPNDPLFLEPHEEMTLCKYY
EKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNV
SSPQKEGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDIKTRYPM
LENPEILRKTADDFLSRIALTDAYLLYTPSQIALTAILSRASRAGITMESYLSESLMLKE
NRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAILKQKLERCHSSDLALNMVTKKRKGYEDD
DYVSKKPKQEEEEWTDDDLVDAL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtaccacaacagcagccagaagcggcactggaccttcgctagcgaggagcaactggcg
cgtctgcgggccgacgccaaccgcaaattcaagtgcaaagctgtggctaacgggaaggtt
cttccaaatgatccgttgtttcttgagcctcatgaagaaatgacactttgcaaatactat
gaaaaaagattgttggaattttgttcagtgtttaaaccagctatgccacggtctgttgtg
ggtacagcttgtatgtatttcaagcgtttttatcttaataactcagtaatggaatatcac
cctcggataataatgcttacttgtgcatttttggcctgcaaagtagatgaattcaatgtg
tctagtcctcagaaagaagggaaccttcgagagagtcctcttggacaggagaaggcactg
gaacagattttggaatatgaactactacttatacaacaacttaattttcacctcattgtc
cacaatccatatagaccatttgaaggcttcctcattgatataaagactcgataccccatg
ttggagaatccagagattttgaggaaaacggctgatgattttcttagtagaattgcattg
acagatgcttatcttttgtacacaccttcacaaattgccctgactgccattttatcaaga
gcctctagggctggaattactatggaaagctatttatcagagagtctaatgctgaaagag
aacagaacttgcctgtcacagctactggatataatgaaaagcatgagaaatctagtaaaa
aagtatgagccacccagatctgaagaagttgctattctgaaacagaagttggagcgatgt
cattcttctgaccttgcacttaatatggttacaaagaagaggaaaggctacgaagacgat
gactatgtatcaaagaaacccaaacaggaagaggaggagtggacggacgatgacctggta
gatgctctctaa

DBGET integrated database retrieval system