KEGG   Rattus norvegicus (rat): 84430Help
Entry
84430             CDS       T01003                                 

Gene name
Pomt1
Definition
(RefSeq) protein-O-mannosyltransferase 1
  KO
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
rno  Rattus norvegicus (rat)
Pathway
Other types of O-glycan biosynthesis
Mannose type O-glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
  Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosyntheis
    84430 (Pomt1)
   00514 Other types of O-glycan biosynthesis
    84430 (Pomt1)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     84430 (Pomt1)
Glycosyltransferases [BR:rno01003]
 O-Glycan biosynthesis
  O-linked Man type
   84430 (Pomt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RGD: 
UniProt: 
Position
3p12
AA seq 747 aa AA seqDB search
MGNRSMGREDTLGVLPSLLFCKMLRFLKRPLVVTIDINLNLVALTVLGLLTRLWQLSYPR
AVVFDEVYYGQYISFYMKRVFFLDDSGPPFGHMLLALGGWLGGFDGNFLWNRIGAEYSSN
VPVWSLRLLPALAGALSVPMAYQIVLELHFSHCTAMGAALLMLIENALITQSRLMLLESI
LIFFNLLAVLSYLKFFNSQTHSPFSVHWWLWLMLTGVSCSCAVGIKYMGIFTYLLVLSIA
AVHAWHLIGDQTLSNICVLSHLLARAVALLVVPVFLYLLFFYVHLMLLYRSGPHDQIMSS
AFQASLEGGLARITQGQPLEVAFGSQVTLKSVSGKPLPCWLHSHKNTYPMIYENGRGSSH
QQQVTCYPFKDINNWWIVKDPGRHQLVVNNPPRPVRHGDIVQLVHGMTTRLLNTHDVAAP
LSPHSQEVSCYIDYNISMPAQNLWKLDIVNRESNQDTWKTILSEVRFVHVNTSAILKLSG
AHLPDWGFRQLEVVGEKLSLGPHESMVWNVEEHRYGRGHEQKERELELHSPTQHDISRNL
SFMARFSELQWKMLTLKNEDLEHQYSSTPLEWLTLDTNIAYWLHPRTSAQIHLLGNIVIW
TSASLATVAYTLLFFWYLLRRRRNICDLPEDAWSHWVLAGALCIGGWALNYLPFFLMERM
LFLYHYLPALTFQILLLPIVMQHASDHLCRSQLQRNVFSALVVAWYSSACHVSNMLRPLT
YGDTSLSPGELRALRWKDSWDILIRKY
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atggggaaccgctcaatgggacgcgaagatacgcttggtgtcctcccgagcttgcttttc
tgcaaaatgttgagatttttgaaacggcctctagtggtgactattgacatcaatttgaat
ttggtggctctgactgtcctgggactacttacccggttatggcaactctcctaccctcgg
gctgtggtttttgatgaagtgtattacgggcagtacatctccttttacatgaagcgtgtc
ttcttcctggatgacagtggaccaccgttcggccatatgctgctagccttaggaggttgg
ctaggaggattcgatgggaactttctgtggaaccgaattggagcagaatacagtagcaat
gtgcctgtatggtccttacgcctgctgccggcgcttgctggggccctgtcagtacccatg
gcctaccagatagtgttggagctccacttttcccactgtactgccatgggagccgccctg
ctgatgctcattgagaacgccctaatcactcagtccaggctcatgctgttggaatccata
ctgatattttttaacctcttggccgtgttgtcctatctgaagttcttcaactcccaaaca
cacagccctttctcagtgcactggtggctgtggctaatgctgaccggagtctcttgttcc
tgtgcggttgggatcaagtacatgggcattttcacctacttgctcgtgctcagcattgca
gctgtgcatgcctggcacctgatcggagaccagaccttgtcaaatatctgcgtgctcagt
cacttgctcgccagagccgtagctctgctggtcgtcccggtcttcctgtacttactgttc
ttctatgtccacctgatgttgctctaccgctctgggccccatgaccaaatcatgtccagt
gccttccaagccagcttggagggagggctagcccgcatcacccaaggccagcccctagag
gtggcctttggttcgcaggtcactctgaagagcgtctccggcaaacccttgccctgctgg
cttcattcgcacaagaacacctatcccatgatatatgagaatggccgtggcagctcccac
cagcaacaggtgacctgttatcccttcaaagacatcaataactggtggatcgtcaaggac
cctggacgacaccagctggtggtaaacaacccccccaggcctgtgagacatggagacatt
gtacagctcgttcacggcatgaccacccgcctgcttaacacgcatgatgtcgctgccccg
ctgagcccccattctcaagaagtctcctgctacattgactataacatctccatgcctgcc
cagaacctctggaaactggacattgtaaacagagagtccaaccaggatacctggaagact
atcttgtcagaagtgcgctttgtgcatgtgaatacatctgccatcttgaagctgagcggg
gctcacctccctgactggggatttcggcagttggaggtggttggggagaagttgtccctc
ggcccccacgagagcatggtatggaatgtggaagagcaccgctatggcagaggccatgag
cagaaggagagggagctggagctccactcacccacgcagcatgatatcagcaggaacctc
agcttcatggccagattctcggagttacagtggaagatgctgacgctgaagaatgaggac
ttagaacaccagtacagctccaccccgctggagtggctcacgctggacaccaacattgcc
tattggctgcaccccaggaccagtgcccagatccacttgcttggaaacatcgtgatctgg
acttcagccagcctcgccacagtggcatacaccctactcttcttctggtacctgctccgc
cgtcgaaggaacatctgtgacctccctgaggatgcctggtcccactgggtgctggctgga
gccctgtgtattggcggttgggcactcaactatctgcccttcttcctgatggaaaggatg
ctcttcctctaccactacttgccggccctcaccttccagatcctgctgctcccaatcgtc
atgcagcacgccagcgaccatctgtgcaggtcccagctgcagaggaatgtcttcagtgcc
ctggtggtagcatggtattcctctgcgtgccatgtgtccaacatgttacgcccactgacc
tatggggacacgtcactctcaccaggcgagctccgggcccttcgctggaaagacagctgg
gacattctcatccgaaaatactag

DBGET integrated database retrieval system