KEGG   Rattus norvegicus (rat): 84487Help
Entry
84487             CDS       T01003                                 

Gene name
Slc17a6, Dnpi, Vglut2
Definition
(RefSeq) solute carrier family 17 member 6
  KO
K12302  
MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6/7/8
Organism
rno  Rattus norvegicus (rat)
Pathway
Synaptic vesicle cycle
Retrograde endocannabinoid signaling
Glutamatergic synapse
Nicotine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    84487 (Slc17a6)
   04723 Retrograde endocannabinoid signaling
    84487 (Slc17a6)
   04721 Synaptic vesicle cycle
    84487 (Slc17a6)
 Human Diseases
  Substance dependence
   05033 Nicotine addiction
    84487 (Slc17a6)
Transporters [BR:rno02000]
 Solute Carrier Family (SLC)
  SLC17: Vesicular glutamate transporter
   84487 (Slc17a6)
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    84487 (Slc17a6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q22
AA seq 582 aa AA seqDB search
MESVKQRILAPGKEGIKNFAGKSLGQIYRVLEKKQDNRETIELTEDGKPLEVPEKKAPLC
DCTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTIHRGGKVIKEKAKFNWD
PETVGMIHGSFFWGYIITQIPGGYIASRLAANRVFGAAILLTSTLNMLIPSAARVHYGCV
IFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYT
GWSSVFYVYGSFGMVWYMFWLLVSYESPAKHPTITDEERRYIEESIGESANLLGAMEKFK
TPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMT
IIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHTRGVAISFLVLAV
GFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKNKSREEWQYVF
LIAALVHYGGVIFYALFASGEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGT
TKSYGATSQENGGWPNGWEKKEEFVQESAQDAYSYKDRDDYS
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atggagtcggtaaaacaaaggattttggccccggggaaagaggggataaagaattttgct
ggaaaatccctcggacagatctacagggtgctggagaagaagcaggataaccgagagacc
atcgagctgacagaggacggcaagcccctggaggtgcctgagaagaaggctccgctatgc
gactgtacgtgcttcggcctgccgcgccgctacatcatagccatcatgagcggcctcggc
ttctgcatctcctttggtatccgctgtaacctgggtgtggccattgtggacatggtcaac
aacagcaccatccaccggggtggcaaagttatcaaggagaaagccaagtttaactgggac
cccgagactgtggggatgattcacgggtcgttcttctggggctatatcatcacgcagatt
ccgggcggatacatcgcatcgcgactggctgctaaccgggtctttggggctgccatactg
cttacctctaccctcaatatgctgatcccatctgcagccagagtgcattatggatgcgtc
atctttgttagaatattgcaaggacttgtggagggcgtcacctacccagcctgtcacggg
atatggagcaagtgggcccctcctttggagaggagtaggttggctaccacctccttctgt
ggttcctatgctggagcagtcattgcaatgcccctagctggtatcctggtgcagtacact
ggatggtcttcagtattttacgtatatggaagctttggtatggtctggtatatgttctgg
cttctggtgtcttacgagagccccgcaaagcatccaaccataacagacgaagaacgtagg
tacatagaagagagcatcggggagagcgcaaatctgttaggagcaatggagaaattcaag
accccatggaggaagtttttcacatccatgcccgtctatgcgataattgttgcaaacttc
tgcaggagttggactttttatttactgctcatcagtcaaccagcttatttcgaggaggtt
tttggatttgaaatcagcaaggttggcatgttgtctgcggtcccacacctggtcatgaca
atcattgtgcctatcggggggcaaattgcagactttctaaggagcaagcaaattctttca
acaactacagtgcgaaagatcatgaactgcgggggttttggcatggaagccacactgctt
ctggttgttggctactctcatactagaggggtggccatctccttcttggtgcttgcagtg
ggattcagtggatttgctatctctggtttcaatgtgaaccacttggatattgccccgaga
tatgccagtatcttaatgggcatttcaaatggtgttggcacgctgtcgggaatggtctgc
ccgatcattgttggtgcaatgacgaagaacaagtcccgtgaagaatggcagtatgtcttc
ctcatcgctgcactggtccactatggtggagtcatattttatgcactatttgcctcagga
gagaagcaaccttgggcagaccctgaggaaacaagcgaagaaaagtgtggcttcattcat
gaagatgaactggatgaagaaacgggggacatcactcagaattacataaattacggtacc
accaaatcctacggcgccacctcacaggagaacggaggctggcctaacggctgggagaaa
aaggaagaatttgtgcaagaaagtgcgcaagacgcgtactcctataaggaccgagatgat
tattcataa

DBGET integrated database retrieval system