KEGG   Rattus norvegicus (rat): 84580Help
Entry
84580             CDS       T01003                                 

Gene name
Hdac5
Definition
histone deacetylase 5 (EC:3.5.1.98)
Orthology
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
rno  Rattus norvegicus (rat)
Pathway
Alcoholism
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    84580 (Hdac5)
  Substance dependence
   05034 Alcoholism
    84580 (Hdac5)
  Infectious diseases
   05169 Epstein-Barr virus infection
    84580 (Hdac5)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     84580 (Hdac5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
Position
10q32.1
AA seq 1113 aa AA seqDB search
MNSPNESDGMSGREPSLEILPRTPLHSIPVAVEVKPVLPAAMPSSMGGGGGGSPSPVELR
GALAGPMDPALREQQLQQELLVLKQQQQLQKQLLFAEFQKQHDHLTRQHEVQLQKHLKQQ
QEMLAAKRQQELEQQRQREQQRQEELEKQRLEQQLLILRNKEKSKESAIASTEVKLRLQE
FLLSKSKEPTPGGLNHSLPQHPKCWGAHHASLDQSSPPQSGPPGTPPSYKLPLLGPYDSR
DDFPLRKTASEPNLKVRSRLKQKVAERRSSPLLRRKDGTVISTFKKRAVEITGTGPGVSS
VCNSAPGSGPSSPNSSHSTIAENGFTGSVPNIPTEMLPQHRALPLDSSPNQFSLYTSPSL
PNISLGLQATVTVTNSHLTASPKLSTQQEAERQALQSLRQGSTLTGKFMSTSSIPGCLLG
VALEGDTSPHGHASLLQHVLLLEQARQQSTLIAVPLHGQSPLVTGERVATSMRTVGKLPR
HRPLSRTQSSPLPQSPQALQQLVMQQQHQQFLEKQKQQQMQLGKILTKTGELSRQPTTHP
EETEEELTEQQEALLGEGALTMPREGSTESESTQEDLEEEEDEEEDEEDCIQVKDEDGES
GPDEGADLEESSAGYKKLFADAQQLQPLQVYQAPLSLATVPHQALGRTQSSPAAPGSMKS
PTDHPTVVKHLFTTGVVYDTFMLKHQCMCGNTHVHPEHAGRIQSIWSRLQETGLLSKCER
IRGRKATLDEIQTVHSEYHTLLYGTSPLNRQKLDSKKLLGPISQKMYAMLPCGGIGVDSD
TVWNEMHSSSAVRMAVGCLVELAFKVAAGELKNGFAIIRPPGHHAEESTAMGFCFFNSVA
ITAKLLQQKLSVGKVLIVDWDIHHGNGTQQAFYDDPSVLYISLHRYDNGNFFPGSGAPEE
VGGGPGVGYNVNVAWTGGVDPPIGDVEYLTAFRTVVMPIAHEFSPDVVLVSAGFDAVEGH
LSPLGGYSVTARCFGHLTRQLMTLAGGRVVLALEGGHDLTAICDASEACVSALLSVELQP
LDEAVLQQKPSVNAVATLEKVIEIQSKHWSCVQRFATGLGCSLREAQTGEKEEAETVSAM
ALLSMGAEQAQAAATQEHSPRPAEEPMEQEPAL
NT seq 3342 nt NT seq  +upstreamnt  +downstreamnt
atgaactctcccaacgagtcggatggcatgtcaggccgggaaccatccttggaaatcttg
ccacggactcctctgcacagcatccctgtggcagtggaggtgaagccggtgctgccagca
gccatgcccagctccatgggaggtggaggtggaggtagccccagccctgtggagcttcgg
ggggctctggcaggccccatggaccccgcgcttcgggagcagcaactgcagcaagagctc
ctggtgctcaagcagcagcagcagctgcaaaagcagctcctgtttgccgagtttcagaag
cagcacgaccacctgacgcggcagcatgaagtccagctgcagaagcacctcaagcagcag
caggagatgctggcggctaagaggcagcaggagctggagcagcagcggcagcgcgagcag
cagcggcaagaggagctagagaaacagcggctggagcagcagctgcttattctacgaaac
aaggagaagagcaaagagagtgccatcgccagcaccgaggtaaagctgaggctccaggaa
ttcctgttgtccaagtcaaaggagcccacaccaggcggcctcaaccattccctcccacag
caccccaaatgctggggagcccatcatgcttctttggaccagagttcccctccccagagc
ggccctcctgggacgcctccctcctacaaattgcctttgcttgggccctatgacagccgt
gatgactttcccctccgtaaaacggcctcggaacccaacttaaaagtacgttcaaggcta
aaacagaaggtagctgagagaagaagcagtcccctcctgcgtcgaaaggatggcactgtt
attagtacttttaagaagagagcagtcgagatcacaggcacagggcctggggtgtcgtcc
gtgtgtaacagtgcgcctggctctggccccagctctcccaacagttcccacagcaccatc
gctgagaacggctttactggctcagtccccaacatccccactgagatgctcccccagcac
cgggccctccctctggacagttccccaaaccagttcagcctctacacgtctccttctctg
cctaacatctccctagggctgcaggccactgtcactgttaccaactcgcacctcaccgcc
tccccgaagctgtcgacacagcaggaggctgagaggcaggcccttcagtccctgcggcag
ggcagcacactgaccggcaagttcatgagcacatcctccatccctggctgcctgctggga
gtggccctggagggcgacacgagcccccatgggcacgcttccctgctgcagcacgttttg
ctgctggagcaggcccggcaacagagcacgctcatagcggtgccactccatgggcagtcc
ccactggtgacgggtgaacgtgtggccaccagcatgaggacagtgggcaagctcccaagg
caccgacctctgagccgtactcagtcctcgcccctgccgcagagtccccaggccctgcag
cagctggttatgcagcagcagcaccagcagttcctagagaaacagaagcagcagcagatg
cagctgggcaagatccttaccaaaactggggagctgtcaaggcagcccaccacccaccct
gaagagacagaggaggagctgacggaacagcaggaggccttgctgggggagggggccctg
accatgccccgggaaggttctacagagagcgagagcacccaggaagatctagaagaggaa
gaggatgaggaggaggacgaggaggactgcattcaggtcaaggatgaggatggcgagagt
ggtcctgatgagggcgcagacttggaggagtccagtgctggttacaaaaagttgttcgca
gatgcccagcagttacagcccctccaggtataccaggcacccctcagcctggccactgtg
cctcatcaggccctgggccgcacccagtcctcacctgctgctcctgggagcatgaagagc
cccacagaccaccccactgtggtgaagcacctcttcaccacaggtgtggtctatgacacg
ttcatgctgaagcatcagtgtatgtgcggaaacacacatgtgcacccagagcacgccggc
cgcatccagagcatctggtcccggctgcaggaaactggtctgctcagcaagtgtgagcgg
atccggggtcgtaaagccacactggatgaaatccagaccgtgcactctgagtaccacacc
ctgctctatgggaccagtccccttaaccggcagaagctggacagtaagaagctgcttggc
cccatcagccagaagatgtacgccatgctgccttgtgggggcattggggtggacagtgac
actgtgtggaatgagatgcactcctctagtgccgtgcgaatggcagtgggctgcctggtg
gagctggccttcaaggtggctgcaggagagctcaagaatggatttgccatcatccgaccc
ccaggacatcatgctgaggagtccacagccatgggattctgcttcttcaactccgtagcc
atcacagctaaactcctgcagcagaagctgagcgtgggcaaggtcctcatcgtggactgg
gacattcaccacggcaatggcacccagcaagcattttacgatgacccctccgtgctctac
atctctttgcatcgctacgacaatgggaacttctttccaggctccggggctcctgaagag
gttggtggagggccaggtgtggggtacaacgtaaatgtggcgtggacaggaggtgtggat
ccccccattggagatgtggaatacctgacagccttcaggacagtagtgatgcccattgcc
cacgagttctcacccgacgtcgttctagtctccgctgggtttgatgctgttgaaggacat
ctgtctccactgggtggctattctgtcaccgccagatgttttggccacttgaccaggcag
ctcatgacactggcagggggccgggtggtgctggccctggagggaggtcatgacttgacc
gccatctgtgatgcttctgaggcctgtgtctcggctctgctcagcgtggagctgcagccc
ttggatgaagcagtcttgcagcaaaagcccagcgtcaatgcagttgccacactagagaaa
gtcatcgagatccagagcaaacactggagctgtgtacagaggtttgccactggtctgggc
tgctcgctgcgggaggctcagacgggtgagaaagaggaggccgagactgtgagcgccatg
gccctgctttccatgggggctgagcaggcccaggctgctgccactcaagagcacagcccc
cggccagccgaggagcccatggagcaggagcctgccctgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system