KEGG   Rattus norvegicus (rat): 85239Help
Entry
85239             CDS       T01003                                 

Gene name
Mlycd, Mcd
Definition
malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
rno  Rattus norvegicus (rat)
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    85239 (Mlycd)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    85239 (Mlycd)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    85239 (Mlycd)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    85239 (Mlycd)
Enzymes [BR:rno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     85239 (Mlycd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
19q12
AA seq 491 aa AA seqDB search
MRGLGPSLRARRLLPLRYPPRPPGPRGPRLCSGLTASAMDELLRRAVPPTPAYELREKTP
APAEGQCADFVSFYGGLAEAAQRAELLGRLAQGFGVDHGQVAEQSAGVLQLRQQSREAAV
LLQAEDRLRYALVPRYRGLFHHISKLDGGVRFLVQLRADLLEAQALKLVEGPHVREMNGV
LKSMLSEWFSSGFLNLERVTWHSPCEVLQKISDCEAVQPVKNWMDMKRRVGPYRRCYFFS
HCSTPGDPLVVLHVALTGDISNNIQSIVKECPPSETEEKNRIAAAVFYSISLTQQGLQGV
GLGTFLIKRVVKELQKEFPHLGAFSSLSPIPGFTKWLLGLLNVQGKEYGRNELFTDSECK
EIAEVTGDPVHESLKGLLSSGEWAKSEKLAQALQGPLMRLCAWYLYGEKHRYALNPVANF
HLQNGAVMWRINWMADSSLKGLTSSCGLMVNYRYYLEETGPNSISYLGSKNIKASEQILS
LVAQFQSNSKL
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgagaggcttggggccaagcttgagggctcggcgcctgctcccactgcggtacccgccg
cggcctccggggcctcggggacctaggctgtgcagcgggctcacggctagcgccatggac
gagctgctacggcgagccgtgccacccacgccggcctacgagctgcgcgagaagacgccg
gccccggccgaggggcagtgcgcggacttcgtgagcttttacggcggcctggccgaggcg
gcccagcgcgccgagctgctcggccgcctggctcagggcttcggcgtggatcacggccag
gtagcggagcagagcgccggagtgctgcagctgcgccagcagtcgcgcgaggcggccgtg
ctgctgcaggcagaggaccggctacgctatgccctcgtgccgcgataccgtggcctcttc
caccacatcagtaagctggacggcggcgtgcgcttcctggtacagctgcgggccgatctg
ctggaggcgcaggccctcaagctggtggaagggccgcacgtccgggaaatgaacggagtg
ctaaaaagcatgctgtccgagtggttctcctctggcttcctgaacctggagcgggtcacc
tggcactcgccctgtgaggtgcttcagaagatcagcgattgtgaggctgtgcagcctgtg
aaaaactggatggacatgaagcggcgtgtggggccataccggaggtgttacttcttctcc
cactgctccacccccggggaccccctggttgttctgcatgtggctctgaccggtgacatt
tccaacaacatccagagcattgtgaaagagtgccctccgtctgaaacagaggagaagaac
cggatcgctgctgctgtcttctactccatcagcctgacccagcagggcctgcagggcgtg
ggactcggcaccttcctcataaagcgagtggtcaaggagctgcagaaggagtttcctcat
ctgggggccttttccagcctgtcacctatacccggattcaccaagtggctgctgggcctt
ctgaatgtgcagggaaaggagtatgggaggaacgagctgttcacagactcagagtgcaaa
gaaatcgcagaggtcacgggcgaccctgttcacgagagcctcaagggtctcctgagcagt
ggtgagtgggcgaagtctgagaagctggcacaggcactgcaggggccactgatgagactg
tgtgcctggtacctttacggtgagaagcaccgatacgccctcaatccagtggccaacttc
cacctgcagaacggggctgtgatgtggcgtatcaactggatggctgacagcagcctcaaa
ggcctcaccagctcgtgcggcctcatggtcaactaccgttactacctggaggagaccggc
cccaacagcatctcctacctgggctccaagaacatcaaagcttccgagcagatcctcagc
ctggtagcccagttccagagcaacagcaaactctag

DBGET integrated database retrieval system