KEGG   Rattus norvegicus (rat): 85384Help
Entry
85384             CDS       T01003                                 

Gene name
Sos2, Sos1
Definition
(RefSeq) SOS Ras/Rho guanine nucleotide exchange factor 2
  KO
K03099  son of sevenless
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno01522  Endocrine resistance
rno04010  MAPK signaling pathway
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04062  Chemokine signaling pathway
rno04068  FoxO signaling pathway
rno04072  Phospholipase D signaling pathway
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04540  Gap junction
rno04630  Jak-STAT signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04714  Thermogenesis
rno04722  Neurotrophin signaling pathway
rno04810  Regulation of actin cytoskeleton
rno04910  Insulin signaling pathway
rno04912  GnRH signaling pathway
rno04915  Estrogen signaling pathway
rno04917  Prolactin signaling pathway
rno04926  Relaxin signaling pathway
rno05034  Alcoholism
rno05160  Hepatitis C
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05210  Colorectal cancer
rno05211  Renal cell carcinoma
rno05213  Endometrial cancer
rno05214  Glioma
rno05215  Prostate cancer
rno05220  Chronic myeloid leukemia
rno05221  Acute myeloid leukemia
rno05223  Non-small cell lung cancer
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
rno05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    85384 (Sos2)
   04010 MAPK signaling pathway
    85384 (Sos2)
   04012 ErbB signaling pathway
    85384 (Sos2)
   04630 Jak-STAT signaling pathway
    85384 (Sos2)
   04068 FoxO signaling pathway
    85384 (Sos2)
   04072 Phospholipase D signaling pathway
    85384 (Sos2)
   04151 PI3K-Akt signaling pathway
    85384 (Sos2)
   04150 mTOR signaling pathway
    85384 (Sos2)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    85384 (Sos2)
   04540 Gap junction
    85384 (Sos2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    85384 (Sos2)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    85384 (Sos2)
   04660 T cell receptor signaling pathway
    85384 (Sos2)
   04662 B cell receptor signaling pathway
    85384 (Sos2)
   04664 Fc epsilon RI signaling pathway
    85384 (Sos2)
   04062 Chemokine signaling pathway
    85384 (Sos2)
  Endocrine system
   04910 Insulin signaling pathway
    85384 (Sos2)
   04912 GnRH signaling pathway
    85384 (Sos2)
   04915 Estrogen signaling pathway
    85384 (Sos2)
   04917 Prolactin signaling pathway
    85384 (Sos2)
   04926 Relaxin signaling pathway
    85384 (Sos2)
  Nervous system
   04722 Neurotrophin signaling pathway
    85384 (Sos2)
  Environmental adaptation
   04714 Thermogenesis
    85384 (Sos2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    85384 (Sos2)
   05231 Choline metabolism in cancer
    85384 (Sos2)
   05206 MicroRNAs in cancer
    85384 (Sos2)
   05205 Proteoglycans in cancer
    85384 (Sos2)
   05210 Colorectal cancer
    85384 (Sos2)
   05225 Hepatocellular carcinoma
    85384 (Sos2)
   05226 Gastric cancer
    85384 (Sos2)
   05214 Glioma
    85384 (Sos2)
   05221 Acute myeloid leukemia
    85384 (Sos2)
   05220 Chronic myeloid leukemia
    85384 (Sos2)
   05211 Renal cell carcinoma
    85384 (Sos2)
   05215 Prostate cancer
    85384 (Sos2)
   05213 Endometrial cancer
    85384 (Sos2)
   05224 Breast cancer
    85384 (Sos2)
   05223 Non-small cell lung cancer
    85384 (Sos2)
  Substance dependence
   05034 Alcoholism
    85384 (Sos2)
  Infectious diseases
   05160 Hepatitis C
    85384 (Sos2)
   05165 Human papillomavirus infection
    85384 (Sos2)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    85384 (Sos2)
   01522 Endocrine resistance
    85384 (Sos2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH IQ_SEC7_PH Borrelia_lipo_2
Motif
Other DBs
NCBI-GeneID: 85384
NCBI-ProteinID: NP_001129033
RGD: 620435
Ensembl: ENSRNOG00000004826
UniProt: F1MAI3
Position
6q24
AA seq 1333 aa AA seqDB search
MQQAPQPYEFFSEENSPKWRGLLVPALRKVQEQVHPTLSANEESLYYIEELIFQLLNKLC
LAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDD
DIGLVSLCEEEPCSSGELNYYDLVRTEIAEERQYLRELNMIIKVFREAFLSDKKLFKSSE
IEKIFSNISDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQD
ILAPEFNDHFSKLMARPAVALHFQSIADGFKEAVRYVLPRLMLVPVYHCWHYFELLKQLK
ACSEEQEDRECLNQAITALMNLQGSMDRIYKQHSPRRRPGDPVCLFYNRQLRSKHLAIKK
MNEIQKNIDGWEGKDIGQCCNEFIMEGPLTRIGAKHERHIFLFDGLMISCKPNHCQTRLP
GYSSAEYRLKEKFVMRKIQICDKEDACEYKHAFELVSKDENSVIFAAKSAEEKNNWMAAL
ISLHYRSTLDRMLDSVLLKEENEQPLRLPRPDVYRFVVTDSEENIVFEDNLQSRSGIPII
KGGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPDPEPTEADKL
ALEKGEQPISADLKRFRKEYVQPVQLRVLNVFRHWVEHHFYDFERDLELLERLEAFISSV
RGKAMKKWVESIAKIIKRKKQAQANGVSHNITFESPPPPVEWHISRAGQSETFDLMTLHP
IEIARQLTLLESDLYRRVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVE
AENFEERVAVLSRIVEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKRRVL
DDAVELSQDHFKKYLVKLKSINPPCVPFFGIYLTNILKTEEGNSDFLKRKGKDLINFSKR
RKVAEITGEIQQYQNQPYCLRTEPEMRRFFENLNPMGLLSEKEFTDYLFNKSHEIEPRNC
KQPPRFPRKSTFSLKSPGIRPNASRHGSTSGTFRGHPTPLEREPYKISFSRIAETELEST
VSAPTSPNTPSTPPVSASSDHSVFLDVDLNSSCGSNTIFAPVLLPHSKSFFSSCGSLHKL
SEEPLVPPPLPPRKKFDHDAPNSKGAMKSDDDPPAIPPRQPPPPKVKPRAPVLTGTFEGP
VPSPPPPPPRDPLPDTPPPVPLRPPEHFINCPFNLQPPPLGHPHRDPDWLRDVSTCPNSP
STPPPTPSPRIPRRCHLPSPSHNNLAHPPAPPVPPRQNSSPHLPKLPPKTYKRELSHPPL
YRLPLFENAETPQ
NT seq 4002 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaggcgccgcagccctacgagttcttcagcgaagagaacagcccgaaatggcgg
ggactgttggtcccggccctgcggaaggttcaggagcaagtgcaccccaccctgtcggct
aacgaagagtctctctattacatcgaagaactcatctttcaactgctcaataagctgtgc
ctggctcaaccgaggactgttcaagatgttgaggaacgagttcaaaagacttttcctcat
cctattgataaatgggcaattgctgatgcacagtctgccatagagaaacgaaaacgaaga
aatcctctcttactacctgtggacaaaatccatccttccttgaaggaagttttggggtat
aaagtggactaccatgtatccctctacattgtggctgtattggagtatatctcagcagat
attttgaaattggctggtaattatgtttttaatatccggcattatgaaatatctcagcaa
gacattaaagtgtcaatgtgtgcagataaggttttgatggacatgtttgaccaggatgac
gatataggcttggtttctctctgtgaagaggaaccttgttcttctggtgagctaaactat
tatgaccttgttagaactgaaatcgcagaagaaagacagtatctacgggaactgaatatg
atcattaaagtattccgggaagcctttctttcagacaaaaagttgttcaagtcttctgaa
attgaaaagattttcagtaacatttcagatatacatgaactgactgtgaaacttttaggt
ttgattgaagacacagtagaaatgacagatgaaagcagtcctcacccgctagctggtagc
tgctttgaagatttagcagaggagcaggcttttgacccctatgaaacgttatcacaggac
attcttgctccagagtttaatgaccacttcagcaagttgatggccagacctgcagttgct
ctgcactttcagtccattgctgacggctttaaggaggctgttcgatatgtccttccgcgc
ctcatgctggtgccggtgtatcattgttggcattactttgaattattaaagcagttgaaa
gcatgtagcgaagaacaggaagaccgagagtgtttgaatcaggctatcactgccctcatg
aacctccaaggcagcatggaccggatttacaagcagcactcgccaaggcgccggccaggg
gatcctgtttgccttttttacaatcgtcaattaagaagcaagcacctggctatcaaaaaa
atgaatgaaattcagaaaaacattgatgggtgggaaggcaaagatattggacagtgttgt
aatgagttcataatggaaggaccattgaccagaattggtgctaagcatgaaaggcatatt
ttcctcttcgatggcttaatgatcagctgtaaacccaatcattgccagactcgacttcca
gggtatagtagtgcagaatacaggttaaaagagaagtttgtcatgaggaaaattcaaatc
tgtgataaagaagacgcttgtgaatacaaacatgcttttgaattagtatccaaagatgaa
aacagtgtaatatttgctgccaagtcagctgaagagaaaaacaactggatggcagccctt
atctcccttcactatcggagcactctagatagaatgctggactctgtgttactgaaagag
gagaacgagcagcccctgcggctaccgcggccagacgtgtaccgcttcgtggtgacagac
tcagaggagaacatagtttttgaagacaacttgcaaagcagaagtggaatccccattatt
aaaggaggcaccgtggtgaaactgatcgaaaggctaacatatcacatgtatgcagatccc
aattttgttcgtactttccttactacgtatcgttcattttgtaagccacaggaattgcta
agcttgctgatagaacggtttgaaattccagatccagagcctactgaggccgacaaactg
gcgctagagaaaggcgagcagccaatcagcgcagatctgaaaagattccgcaaggaatat
gtccaacccgtgcaacttagggtcttgaatgtctttcgccactgggttgagcatcatttt
tatgactttgaaagagacttggaattgcttgaaagactggaagccttcatttcaagtgta
agagggaaagccatgaagaagtgggtagaatccattgctaaaatcatcaagaggaagaag
caagctcaggccaatggagtaagccataatatcacctttgaaagtccgcctccaccggtt
gaatggcacataagtagggcgggacagtctgaaacctttgaccttatgacacttcatccc
atagagattgcacggcagttaacactcttggaatctgatctctacaggagagtccagcct
tctgaacttgtagggagtgtctggaccaaagaagataaagaaataaattctccaaatcta
ttaaaaatgattcgccatacaacaaacctcactttgtggtttgaaaaatgcattgtggaa
gcagaaaactttgaagaacgggtggcagtgctcagcagaatagtagaaattctgcaagtg
tttcaagatctgaataatttcaatggcgtgttggagatagtcagtgcagtcaattcagtg
tcagtgtacagactagaccacacatttgaggcattgcaggaaaggaagcggagagttttg
gatgacgctgtggaattaagtcaggatcactttaaaaaatacctagtaaaacttaaatca
atcaatccaccttgtgtgcctttttttggaatatatttaacaaatattctgaagactgaa
gaagggaacagcgactttctaaagaggaaagggaaagatttgatcaatttcagtaagagg
agaaaagtggctgaaataaccggagagattcagcagtatcagaaccaaccatactgctta
cggacagaaccagagatgaggagattctttgaaaacctcaatcccatgggacttttatct
gaaaaagagtttacagattatttgttcaacaaatctcatgaaattgaaccccgaaactgc
aaacaaccacctcgatttcctaggaagtcaaccttttccttaaaatctcctggaataagg
cccaatgccagccgccatggctctacctcaggcacgttccgaggtcacccaacccctctg
gaaagggagccttataagataagctttagcaggatcgccgagacggagctagaatccacg
gtgtcagcaccgacatctcccaacaccccatccaccccacctgtgtctgcttcttcagac
cacagcgtgtttctagatgtggacctcaatagctcctgtggcagcaataccatctttgct
ccagtcctcttgccacactcaaagtctttcttcagctcatgtggaagtctacacaaactg
agtgaagagccactagttcctcctccgcttccccctcggaaaaagtttgatcacgatgct
ccgaactccaagggagctatgaaatcggatgatgaccctcctgctattccaccaagacaa
ccccctcctccaaaggtaaagccaagagctcctgtcctcacgggtacatttgaagggcct
gtgcccagtccacctccacctcctcccagagaccctcttcctgatactcctccaccagtt
cctcttcggcctccggaacactttataaactgtccgtttaatctccagccgcctccgctg
ggacatcctcacagagacccagactggctcagagacgttagcacatgccctaattcacca
agcactcctccccctacgccctcgccacggattccacgcagatgccatttgcccagcccc
agtcacaacaatcttgctcaccctccagctcctcccgttccaccaaggcagaattcaagc
cctcacctaccaaaactgccaccaaagacttacaagcgggagctttcacacccgccattg
tacagactacctttgtttgaaaatgcagaaactcctcagtga

DBGET integrated database retrieval system