KEGG   Rattus norvegicus (rat): 85384Help
Entry
85384             CDS       T01003                                 

Gene name
Sos2, Sos1
Definition
son of sevenless homolog 2 (Drosophila)
Orthology
K03099  
son of sevenless
Organism
rno  Rattus norvegicus (rat)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Chemokine signaling pathway
FoxO signaling pathway
PI3K-Akt signaling pathway
Dorso-ventral axis formation
Focal adhesion
Gap junction
Jak-STAT signaling pathway
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Neurotrophin signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Estrogen signaling pathway
Prolactin signaling pathway
Alcoholism
Hepatitis C
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Renal cell carcinoma
Endometrial cancer
Glioma
Prostate cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Non-small cell lung cancer
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:rno04014]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:rno04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:rno04012]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:rno04630]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:rno04068]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:rno04151]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:rno04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:rno04510]
Cellular Processes; Cell communication; Gap junction [PATH:rno04540]
Organismal Systems; Immune system; Natural killer cell mediated cytotoxicity [PATH:rno04650]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:rno04660]
Organismal Systems; Immune system; B cell receptor signaling pathway [PATH:rno04662]
Organismal Systems; Immune system; Fc epsilon RI signaling pathway [PATH:rno04664]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:rno04062]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:rno04910]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:rno04912]
Organismal Systems; Endocrine system; Estrogen signaling pathway [PATH:rno04915]
Organismal Systems; Endocrine system; Prolactin signaling pathway [PATH:rno04917]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:rno04722]
Organismal Systems; Development; Dorso-ventral axis formation [PATH:rno04320]
Human Diseases; Cancers; Pathways in cancer [PATH:rno05200]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:rno05206]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:rno05205]
Human Diseases; Cancers; Glioma [PATH:rno05214]
Human Diseases; Cancers; Acute myeloid leukemia [PATH:rno05221]
Human Diseases; Cancers; Chronic myeloid leukemia [PATH:rno05220]
Human Diseases; Cancers; Renal cell carcinoma [PATH:rno05211]
Human Diseases; Cancers; Prostate cancer [PATH:rno05215]
Human Diseases; Cancers; Endometrial cancer [PATH:rno05213]
Human Diseases; Cancers; Non-small cell lung cancer [PATH:rno05223]
Human Diseases; Substance dependence; Alcoholism [PATH:rno05034]
Human Diseases; Infectious diseases; Hepatitis C [PATH:rno05160]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
6q24
AA seq 1333 aa AA seqDB search
MQQAPQPYEFFSEENSPKWRGLLVPALRKVQEQVHPTLSANEESLYYIEELIFQLLNKLC
LAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDD
DIGLVSLCEEEPCSSGELNYYDLVRTEIAEERQYLRELNMIIKVFREAFLSDKKLFKSSE
IEKIFSNISDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQD
ILAPEFNDHFSKLMARPAVALHFQSIADGFKEAVRYVLPRLMLVPVYHCWHYFELLKQLK
ACSEEQEDRECLNQAITALMNLQGSMDRIYKQHSPRRRPGDPVCLFYNRQLRSKHLAIKK
MNEIQKNIDGWEGKDIGQCCNEFIMEGPLTRIGAKHERHIFLFDGLMISCKPNHCQTRLP
GYSSAEYRLKEKFVMRKIQICDKEDACEYKHAFELVSKDENSVIFAAKSAEEKNNWMAAL
ISLHYRSTLDRMLDSVLLKEENEQPLRLPRPDVYRFVVTDSEENIVFEDNLQSRSGIPII
KGGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPDPEPTEADKL
ALEKGEQPISADLKRFRKEYVQPVQLRVLNVFRHWVEHHFYDFERDLELLERLEAFISSV
RGKAMKKWVESIAKIIKRKKQAQANGVSHNITFESPPPPVEWHISRAGQSETFDLMTLHP
IEIARQLTLLESDLYRRVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVE
AENFEERVAVLSRIVEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKRRVL
DDAVELSQDHFKKYLVKLKSINPPCVPFFGIYLTNILKTEEGNSDFLKRKGKDLINFSKR
RKVAEITGEIQQYQNQPYCLRTEPEMRRFFENLNPMGLLSEKEFTDYLFNKSHEIEPRNC
KQPPRFPRKSTFSLKSPGIRPNASRHGSTSGTFRGHPTPLEREPYKISFSRIAETELEST
VSAPTSPNTPSTPPVSASSDHSVFLDVDLNSSCGSNTIFAPVLLPHSKSFFSSCGSLHKL
SEEPLVPPPLPPRKKFDHDAPNSKGAMKSDDDPPAIPPRQPPPPKVKPRAPVLTGTFEGP
VPSPPPPPPRDPLPDTPPPVPLRPPEHFINCPFNLQPPPLGHPHRDPDWLRDVSTCPNSP
STPPPTPSPRIPRRCHLPSPSHNNLAHPPAPPVPPRQNSSPHLPKLPPKTYKRELSHPPL
YRLPLFENAETPQ
NT seq 4002 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaggcgccgcagccctacgagttcttcagcgaagagaacagcccgaaatggcgg
ggactgttggtcccggccctgcggaaggttcaggagcaagtgcaccccaccctgtcggct
aacgaagagtctctctattacatcgaagaactcatctttcaactgctcaataagctgtgc
ctggctcaaccgaggactgttcaagatgttgaggaacgagttcaaaagacttttcctcat
cctattgataaatgggcaattgctgatgcacagtctgccatagagaaacgaaaacgaaga
aatcctctcttactacctgtggacaaaatccatccttccttgaaggaagttttggggtat
aaagtggactaccatgtatccctctacattgtggctgtattggagtatatctcagcagat
attttgaaattggctggtaattatgtttttaatatccggcattatgaaatatctcagcaa
gacattaaagtgtcaatgtgtgcagataaggttttgatggacatgtttgaccaggatgac
gatataggcttggtttctctctgtgaagaggaaccttgttcttctggtgagctaaactat
tatgaccttgttagaactgaaatcgcagaagaaagacagtatctacgggaactgaatatg
atcattaaagtattccgggaagcctttctttcagacaaaaagttgttcaagtcttctgaa
attgaaaagattttcagtaacatttcagatatacatgaactgactgtgaaacttttaggt
ttgattgaagacacagtagaaatgacagatgaaagcagtcctcacccgctagctggtagc
tgctttgaagatttagcagaggagcaggcttttgacccctatgaaacgttatcacaggac
attcttgctccagagtttaatgaccacttcagcaagttgatggccagacctgcagttgct
ctgcactttcagtccattgctgacggctttaaggaggctgttcgatatgtccttccgcgc
ctcatgctggtgccggtgtatcattgttggcattactttgaattattaaagcagttgaaa
gcatgtagcgaagaacaggaagaccgagagtgtttgaatcaggctatcactgccctcatg
aacctccaaggcagcatggaccggatttacaagcagcactcgccaaggcgccggccaggg
gatcctgtttgccttttttacaatcgtcaattaagaagcaagcacctggctatcaaaaaa
atgaatgaaattcagaaaaacattgatgggtgggaaggcaaagatattggacagtgttgt
aatgagttcataatggaaggaccattgaccagaattggtgctaagcatgaaaggcatatt
ttcctcttcgatggcttaatgatcagctgtaaacccaatcattgccagactcgacttcca
gggtatagtagtgcagaatacaggttaaaagagaagtttgtcatgaggaaaattcaaatc
tgtgataaagaagacgcttgtgaatacaaacatgcttttgaattagtatccaaagatgaa
aacagtgtaatatttgctgccaagtcagctgaagagaaaaacaactggatggcagccctt
atctcccttcactatcggagcactctagatagaatgctggactctgtgttactgaaagag
gagaacgagcagcccctgcggctaccgcggccagacgtgtaccgcttcgtggtgacagac
tcagaggagaacatagtttttgaagacaacttgcaaagcagaagtggaatccccattatt
aaaggaggcaccgtggtgaaactgatcgaaaggctaacatatcacatgtatgcagatccc
aattttgttcgtactttccttactacgtatcgttcattttgtaagccacaggaattgcta
agcttgctgatagaacggtttgaaattccagatccagagcctactgaggccgacaaactg
gcgctagagaaaggcgagcagccaatcagcgcagatctgaaaagattccgcaaggaatat
gtccaacccgtgcaacttagggtcttgaatgtctttcgccactgggttgagcatcatttt
tatgactttgaaagagacttggaattgcttgaaagactggaagccttcatttcaagtgta
agagggaaagccatgaagaagtgggtagaatccattgctaaaatcatcaagaggaagaag
caagctcaggccaatggagtaagccataatatcacctttgaaagtccgcctccaccggtt
gaatggcacataagtagggcgggacagtctgaaacctttgaccttatgacacttcatccc
atagagattgcacggcagttaacactcttggaatctgatctctacaggagagtccagcct
tctgaacttgtagggagtgtctggaccaaagaagataaagaaataaattctccaaatcta
ttaaaaatgattcgccatacaacaaacctcactttgtggtttgaaaaatgcattgtggaa
gcagaaaactttgaagaacgggtggcagtgctcagcagaatagtagaaattctgcaagtg
tttcaagatctgaataatttcaatggcgtgttggagatagtcagtgcagtcaattcagtg
tcagtgtacagactagaccacacatttgaggcattgcaggaaaggaagcggagagttttg
gatgacgctgtggaattaagtcaggatcactttaaaaaatacctagtaaaacttaaatca
atcaatccaccttgtgtgcctttttttggaatatatttaacaaatattctgaagactgaa
gaagggaacagcgactttctaaagaggaaagggaaagatttgatcaatttcagtaagagg
agaaaagtggctgaaataaccggagagattcagcagtatcagaaccaaccatactgctta
cggacagaaccagagatgaggagattctttgaaaacctcaatcccatgggacttttatct
gaaaaagagtttacagattatttgttcaacaaatctcatgaaattgaaccccgaaactgc
aaacaaccacctcgatttcctaggaagtcaaccttttccttaaaatctcctggaataagg
cccaatgccagccgccatggctctacctcaggcacgttccgaggtcacccaacccctctg
gaaagggagccttataagataagctttagcaggatcgccgagacggagctagaatccacg
gtgtcagcaccgacatctcccaacaccccatccaccccacctgtgtctgcttcttcagac
cacagcgtgtttctagatgtggacctcaatagctcctgtggcagcaataccatctttgct
ccagtcctcttgccacactcaaagtctttcttcagctcatgtggaagtctacacaaactg
agtgaagagccactagttcctcctccgcttccccctcggaaaaagtttgatcacgatgct
ccgaactccaagggagctatgaaatcggatgatgaccctcctgctattccaccaagacaa
ccccctcctccaaaggtaaagccaagagctcctgtcctcacgggtacatttgaagggcct
gtgcccagtccacctccacctcctcccagagaccctcttcctgatactcctccaccagtt
cctcttcggcctccggaacactttataaactgtccgtttaatctccagccgcctccgctg
ggacatcctcacagagacccagactggctcagagacgttagcacatgccctaattcacca
agcactcctccccctacgccctcgccacggattccacgcagatgccatttgcccagcccc
agtcacaacaatcttgctcaccctccagctcctcccgttccaccaaggcagaattcaagc
cctcacctaccaaaactgccaccaaagacttacaagcgggagctttcacacccgccattg
tacagactacctttgtttgaaaatgcagaaactcctcagtga

DBGET integrated database retrieval system