KEGG   Rattus norvegicus (rat): 89805Help
Entry
89805             CDS       T01003                                 

Gene name
Angpt2, Agpt2, Ang-2
Definition
angiopoietin 2
Orthology
K05466  
angiopoietin 2
Organism
rno  Rattus norvegicus (rat)
Pathway
Ras signaling pathway
Rap1 signaling pathway
HIF-1 signaling pathway
PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    89805 (Angpt2)
   04015 Rap1 signaling pathway
    89805 (Angpt2)
   04066 HIF-1 signaling pathway
    89805 (Angpt2)
   04151 PI3K-Akt signaling pathway
    89805 (Angpt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
16q12.5
AA seq 496 aa AA seqDB search
MWQIVFLTFGCDLVLASAYNNFRKSVDSTGRRQYQVQNGPCSYTFLLPETDSCRSSSSPY
MSNAVQRDAPLDYDDSVQRLQVLENILENNTQWLMKLENYIQDNMKKEMVEIQQNVVQNQ
TAVMIEIGTSLLNQTAAQTRKLTDVEAQVLNQTTRLELQLLQHSISTNKLEKQILDQTSE
INKLQDKNSFLEKKVLDMEDKHSVQLQSMKEQKDQLQVLVSKQSSVIDELEKKLVTATVN
NSVLQKQQHDLMETVNSLLTMMSSPDYKSSVAVPKEEKTTFRDCAEIFKSGLTTSGIYTL
TFPNSTEEVKAYCDMDMGGGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFV
SQLTSGHRYVLKIQLKDWEGSEAHSLYEHFYLSGEESNYRIHLTGLTGTAGKISSISQPG
SDFSTKDSDNDKCICKCSQMLTGGWWFDACGPSNLNGQYYPQKQNTNKFNGIKWYYWKGS
GYSLKATTMMIRPADF
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgtggcagattgttttcctaacttttggctgtgatcttgtcttggcctcagcctacaat
aactttaggaagagcgtggacagcacgggcaggaggcagtaccaggtccagaacggaccc
tgcagctacacattcctgctgccggagaccgacagctgccgatcttcctccagcccctac
atgtctaacgccgtgcagagggatgcacccctcgactacgacgactcagtgcaaaggctg
caggtgctggagaacattctagagaacaacacacagtggctgatgaagctggagaactac
atccaggacaacatgaagaaggagatggtggagatccagcagaatgtggtgcagaaccag
acggctgtgatgatcgagattggaaccagtttgctcaaccagacggcggcacaaactcgg
aaactgactgatgtggaagcccaagtactaaaccagacgacaagactcgagttgcagctt
cttcaacattctatttctaccaacaaattggaaaagcagattttggaccagaccagtgaa
ataaacaaactacaagataagaacagcttcctagaaaagaaagtgctggacatggaggac
aagcacagtgtgcagctgcagtccatgaaggagcagaaggaccagcttcaggtgctggtg
tccaagcagagctccgtcatcgatgagctggagaagaagctggtgacggccacagtcaac
aactcagtccttcagaagcagcagcatgatctaatggagacggtcaacagcttgctgacc
atgatgtcatcgcccgactataagagctctgttgctgtccctaaagaagagaaaaccacc
ttcagagactgtgcagaaatcttcaagtcaggactcaccaccagtggcatctacacgctg
accttccccaactccacagaggaggtcaaggcctactgtgacatggacatgggtggagga
gggtggacggtcatccaacaccgggaagatggcagcgttgacttccagagaacgtggaaa
gagtacaaagagggcttcgggagccctctgggagagtattggctgggcaacgagtttgtc
tcccagctgaccagtgggcatcgctacgtgctgaagatccagctgaaggactgggaaggc
agcgaggcacactctctgtatgagcacttctacctgtccggcgaggagtccaactacagg
attcaccttacaggactcacaggcacggcgggcaaaatcagtagcatcagccaaccagga
agtgattttagcacaaaggattcggacaatgacaaatgcatctgcaagtgttcccagatg
ctcacaggaggctggtggttcgacgcatgtggtccttccaacttgaatggacagtactac
ccacaaaagcagaatacgaataagttcaacggtatcaagtggtactactggaaggggtcc
ggttactcgctcaaggccacgaccatgatgatccggccagcagatttctaa

DBGET integrated database retrieval system