KEGG   Rattus norvegicus (rat): 89821Help
Entry
89821             CDS       T01003                                 

Gene name
Trpc1, Trrp1
Definition
(RefSeq) transient receptor potential cation channel, subfamily C, member 1
  KO
K04964  
transient receptor potential cation channel subfamily C member 1
Organism
rno  Rattus norvegicus (rat)
Pathway
Axon guidance
Glutamatergic synapse
Serotonergic synapse
Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    89821 (Trpc1)
  Nervous system
   04724 Glutamatergic synapse
    89821 (Trpc1)
   04726 Serotonergic synapse
    89821 (Trpc1)
  Development
   04360 Axon guidance
    89821 (Trpc1)
Ion channels [BR:rno04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPC (Classical)
   89821 (Trpc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RGD: 
Ensembl: 
UniProt: 
Position
8q31
AA seq 759 aa AA seqDB search
MMAALYPSTDLSGVSSSSLPSSPSSSSPNEVMALKDVREVKEENTLNEKLFLLACDKGDY
YMVKKILEENSSGDLNINCVDVLGRNAVTITIENESLDILQLLLDYGCQKLMERIQNPEY
STTMDVAPVILAAHRNNYEILTMLLKQDVALPKPHAVGCECTLCSAKNKKDSLRHSRFRL
DIYRCLASPALIMLTEEDPILRAFELSADLKELSLVEVEFWNDYEELARQCKMFAKDLLA
QARNSRELEVILNHTSSDEPLDKRGLLEERMNLSRLKLAIKYNQKEFVSQSNCQQFLNTV
WFGQMSGYRRKPTCKKIMTVLTVGIFWPVLSLCYLIAPKSQFGRIIHTPFMKFIIHGASY
FTFLLLLNLYSLVYNEDKKNTMGPALERIDYLLILWIIGMIWSDIKRLWYEGLEDFLEES
RNQLSFVMNSLYLATFALKVVAHNKFHDFADRKDWDAFHPTLVAEGLFAFANVLSYLRLF
FMYTTSSILGPLQISMGQMLQDFGKFLGMFLLVLFSFTIGLTQLYDKGYTSKEQKDCVGI
FCEQQSNDTFHSFIGTCFALFWYIFSLAHVAIFVTRFSYGEELQSFVGAVIVGTYNVVVV
IVLTKLLVAMLHKSFQLIANHEDKEWKFARAKLWLSYFDDKCTLPPPFNIIPSPKTICYM
ISSLSKWVCSHTSKGKVRRQNSLKEWRNLKQKRDENYQKVMCCLVHRYLTSMRQKMQSTD
QATVENLNELRQDLSKFRNEIRDLLGFRTSKYAMFYPKN
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atgatggcggccctgtacccgagcacggacctctctggcgtctcctcctcctccctgcct
tcctccccatcctcctcatcgcccaacgaagtgatggcgctgaaggatgtgcgagaggtg
aaggaggagaacaccttgaatgagaagcttttcttgctggcgtgcgacaagggtgactat
tatatggttaaaaagattttggaggaaaacagttcaggtgacttgaacataaattgcgta
gatgtgcttgggagaaatgctgttaccataactattgaaaacgaaagcttggatatactg
cagctgcttttggactacggttgtcagaaacttatggaacgaattcagaatccggaatac
tcaacaacaatggatgttgcaccagttattttagctgctcatcgtaacaactatgagatc
ctcacaatgcttctgaagcaggacgtggctttgcccaagccccatgctgttggctgtgaa
tgcacgctgtgttctgcgaaaaacaaaaaggacagcctcagacattccaggtttcgtctt
gatatctatagatgtctggccagtccagctctaataatgttaacagaggaggatccaatt
ctgagagcgtttgaacttagtgctgacttaaaggaactcagccttgtggaggtggaattc
tggaatgactatgaagagctagcccgtcagtgcaaaatgtttgctaaagatttgcttgcg
caagctcggaattctcgtgaactggaagttatcctaaaccatacatctagtgatgagcct
cttgacaaacgaggactactagaagaaagaatgaatttaagtcgtctgaaacttgctatc
aaatataaccagaaggagtttgtctcccagtcaaattgccagcagttcctgaacaccgtt
tggttcggacagatgtcaggttaccgccgtaagcccacctgtaagaagataatgactgtt
ttgacagttggcattttctggccagttctgtcactgtgttacttgatagctcccaaatct
caattcggcagaatcattcacacaccgttcatgaagtttattattcatggagcttcatat
ttcacattcttgctgttactcaatctctactcacttgtctacaatgaggacaagaaaaat
acaatggggccagcccttgagagaatagactaccttctcatactgtggattattgggatg
atttggtcagacattaagaggctgtggtatgaagggttggaagacttcttagaagaatct
cgtaaccagctcagctttgttatgaattccctttacttggcaacttttgccctcaaagtg
gtggctcacaacaagtttcatgattttgccgaccggaaggactgggatgcgttccacccc
acactggtagcagaagggcttttcgcctttgcaaacgttctgagttaccttcggctcttc
tttatgtacacaaccagctctattttgggcccactgcagatttcaatgggacagatgtta
caagattttgggaaatttctaggaatgttccttcttgttctgttttccttcacgattgga
ctgacacagctctatgacaaagggtacacttccaaagagcagaaggactgcgtaggcatc
ttctgtgaacagcaaagcaacgacaccttccactcgttcattggcacctgctttgctctg
ttctggtacatcttctccttagcgcatgtggccatctttgtcaccaggtttagctatggg
gaagaactgcagtccttcgttggggctgtgattgtcggaacttacaatgtcgtggttgtg
atcgtgcttacaaagctactggtagcgatgcttcataagagcttccagctgatagcaaat
catgaggataaagaatggaagtttgctcgagcgaagctatggctcagctactttgatgac
aaatgcacactgcccccacctttcaacatcattccttctccgaagactatctgctatatg
atcagcagcctcagcaagtgggtgtgctcgcacacctccaaaggcaaggtcagacggcag
aacagcttgaaggagtggagaaacttaaaacaaaagagagatgagaactaccagaaggtg
atgtgctgcctagtgcatcgatacctgacctccatgcgacagaagatgcagagcacagac
caagccaccgtggagaatctcaatgaactgcgccaagatctgtcaaaattccgaaatgaa
ataagggatttgcttggctttcggacttctaaatatgctatgttttatcccaaaaattag

DBGET integrated database retrieval system