KEGG   Rattus norvegicus (rat): 89823Help
Entry
89823             CDS       T01003                                 

Gene name
Trpc6, Trrp6
Definition
(RefSeq) transient receptor potential cation channel, subfamily C, member 6
  KO
K04969  transient receptor potential cation channel subfamily C member 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    89823 (Trpc6)
 Organismal Systems
  Development
   04360 Axon guidance
    89823 (Trpc6)
Ion channels [BR:rno04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPC (Classical)
   89823 (Trpc6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans TRP_2 PKD_channel Ank_2 Ank_5 Ank_4 ING Cytochrom_B562
Motif
Other DBs
NCBI-GeneID: 89823
NCBI-ProteinID: NP_446011
RGD: 619788
Ensembl: ENSRNOG00000006324
UniProt: Q99N78
Position
8q11
AA seq 930 aa AA seqDB search
MSQSPGFVTRRGGSPKAAPGAGARRNESQDYLLMDELGDDGYPQLQQPPYGYYPSFRGNE
NRLTHRRQTVLREKGRRLANRGPAYMFNDHSTSLSIEEERFLDAAEYGNIPVVRKMLEEC
LSLNVNCVDYMGQNALQLAVANEHLEITELLLKKENLSRVGDALLLAISKGYVRIVEAIL
NHPAFAEGKRLATSPSQSELQQDDFYAYDEDGTRFSHDVTPIILAAHCQEYEIVHTLLRK
GARIERPHDYFCKCTECSQKQKHDSFSHSRSRINAYKGLASPAYLSLSSEDPVMTALELS
NELAVLANIEKEFKNDYRKLSMQCKDFVVGLLDLCRNTEEVEAILNGDAETRQPGDLARP
NLSRLKLAIKYEVKKFVAHPNCQQQLLSIWYENLSGLRQQTMAVKFLVVLAVAIGLPFLA
LIYWCAPCSKMGKILRGPFMKFVAHAASFTIFLGLLVMNAADRFEGTKLLPNETSTDNAR
QLFRMKTSCFSWMEMLIISWVIGMIWAECKEIWTQGPKEYLFELWNMLDFGMLAIFAASF
IARFMAFWHASKAQSIIDANDTLKDLTKVTLGDNVKYYNLARIKWDPTDPQIISEGLYAI
AVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYYIG
AKQNEAFTTVEESFKTLFWAIFGLSEVKSVVINYNHKFIENIGYVLYGVYNVTMVIVLLN
MLIAMINSSFQEIEDDADVEWKFARAKLWFSYFEEGRTLPVPFNLVPSPKSLLYLLLKFK
KWMSELIQGHKKGFQEDAEMNKRNEEKKFGILGSHEDLSKFSLDRNQLAHNKQSSTRSSE
DFHLNSFSNPPRQYQKIMKRLIKRYVLQAQIDKESDEVNEGELKEIKQDISSLRYELLEE
KSQNTEDLAELIRKLGERLSLESKQEESRR
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atgagccagagcccggggttcgtgacccggaggggtggctctccgaaggctgcccctgga
gccggcgcgcggcgcaacgagagccaggactatctgctgatggacgagctgggagacgac
ggctacccacagctccagcagccaccttatggctactatcccagcttccggggtaatgaa
aacagactgactcaccggcggcagacagttcttcgtgagaagggaagaaggttggctaat
cgaggaccagcatacatgtttaatgatcactcaaccagcctgtctattgaggaggaacgc
tttctggatgcagctgaatatggcaacatcccagtggtgcggaagatgctagaagaatgt
ctctccctcaatgttaactgtgtggattacatgggccagaatgccctacagttggcggtg
gccaatgagcacctggaaattacagagctgttactcaagaaggaaaacttgtctcgagtt
ggggatgctttacttttagctatcagtaaaggttatgtacggattgtggaggctattctc
aaccatccagcttttgctgaaggcaagaggttggcgacaagccccagccagtctgaactc
cagcaagatgacttttatgcctatgatgaagatgggacaagattctcccacgatgtgacc
ccaatcattctggctgctcattgccaggaatatgaaattgtgcataccctcctgagaaag
ggtgcccggatcgaacggcctcatgattatttctgcaagtgtacagaatgcagccagaaa
caaaagcatgactccttcagccactctagatccaggatcaatgcctacaaagggctggca
agtccagcatacctgtcactgtccagtgaagatccagtcatgacagctttagaactcagc
aatgagctggcagtgcttgccaacattgagaaagagttcaagaatgactacaggaagctg
tccatgcagtgcaaggattttgttgtgggtctcctggacctctgcagaaacacggaggaa
gtggaagccatcctgaacggggatgcagagactcgccagcccggggacctcgctcgtccg
aatctcagccgtttaaaactcgctattaaatatgaagtaaaaaaattcgtggcgcatccg
aactgccagcagcagctcctctccatatggtatgagaacctctctggtttacggcagcag
accatggcagtgaaattcctcgtggtcctcgctgtcgccattggactgcccttcctggct
ctcatatactggtgtgctccttgcagcaagatggggaagatattacgaggtccattcatg
aagttcgtagcacatgcggcctccttcaccattttcctggggctgctcgtcatgaatgca
gctgacagatttgaaggcaccaagctcctccctaatgaaaccagcacagataatgcaagg
cagctgttcaggatgaaaacatcctgtttctcatggatggagatgctcattatatcctgg
gtaataggaatgatatgggctgaatgtaaagaaatctggactcaaggccccaaagaatat
ttatttgagttgtggaatatgcttgactttggaatgttagcaatctttgcagcatcattc
attgcaagatttatggcattctggcatgcatccaaagctcagagcatcatcgatgcaaat
gacactttaaaggacttgacaaaagtcacactgggggacaacgtcaaatactacaatctg
gccaggataaagtgggaccctaccgatcctcagatcatctctgaaggtctttatgcaatc
gcggtggttttaagtttctccagaatagcttacattttaccggcaaatgaaagctttgga
cctctgcagatttcacttggaagaacagtgaaagatatcttcaaattcatggtcatattc
atcatggtgtttgtagcctttatgattggaatgttcaacctctactcctactacattggt
gcaaaacagaatgaagccttcacaacagttgaggaaagttttaagactctgttctgggct
atatttggtctttctgaagtgaagtcggtggtcatcaactacaatcacaagttcattgag
aacataggctatgttctgtatggagtctataatgtcacaatggtcattgttttgctaaat
atgttaattgcgatgatcaacagttcattccaggaaattgaggatgatgcggatgtggag
tggaagtttgcaagggccaaattgtggttttcctactttgaagagggaagaacactgcct
gtccccttcaatcttgtgccaagtccaaagtccctgctttatctcctattgaaatttaag
aaatggatgtctgagcttatccagggtcataagaaaggcttccaagaagatgcagagatg
aacaagagaaatgaagaaaagaaatttggaattttgggaagtcatgaagacctttcaaaa
ttttcacttgacagaaatcagctggcacacaacaaacaatcaagtacaaggagctcagaa
gatttccatttaaatagcttcagtaatcctccaagacagtatcagaaaatcatgaaaaga
ctcattaaaagatacgtactgcaggcccagattgataaggagagtgatgaagtgaacgaa
ggggagctgaaggaaattaagcaggacatctcaagtctccgttatgaactccttgaggaa
aaatcacagaacacagaggacctagcagaactcattagaaagcttggggagagactgtct
ttagagtcgaaacaagaggaaagccgcagatag

DBGET integrated database retrieval system