KEGG   Rattus norvegicus (rat): 94201Help
Entry
94201             CDS       T01003                                 

Gene name
Cdk4
Definition
cyclin-dependent kinase 4 (EC:2.7.11.22)
Orthology
K02089  
cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
rno  Rattus norvegicus (rat)
Pathway
Cell cycle
p53 signaling pathway
PI3K-Akt signaling pathway
Tight junction
T cell receptor signaling pathway
Hepatitis B
Measles
HTLV-I infection
Pathways in cancer
Viral carcinogenesis
Pancreatic cancer
Glioma
Melanoma
Bladder cancer
Chronic myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    94201 (Cdk4)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    94201 (Cdk4)
   04115 p53 signaling pathway
    94201 (Cdk4)
  Cell communication
   04530 Tight junction
    94201 (Cdk4)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    94201 (Cdk4)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    94201 (Cdk4)
   05203 Viral carcinogenesis
    94201 (Cdk4)
   05212 Pancreatic cancer
    94201 (Cdk4)
   05214 Glioma
    94201 (Cdk4)
   05220 Chronic myeloid leukemia
    94201 (Cdk4)
   05218 Melanoma
    94201 (Cdk4)
   05219 Bladder cancer
    94201 (Cdk4)
   05222 Small cell lung cancer
    94201 (Cdk4)
   05223 Non-small cell lung cancer
    94201 (Cdk4)
  Infectious diseases
   05166 HTLV-I infection
    94201 (Cdk4)
   05162 Measles
    94201 (Cdk4)
   05161 Hepatitis B
    94201 (Cdk4)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     94201 (Cdk4)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   94201 (Cdk4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
7q22
AA seq 303 aa AA seqDB search
MATTRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGAAGGGLPVSTVREVALL
RRLEAFEHPNVVRLMDVCATSRTDRDIKVTLVFEHIDQDLRTYLDKAPPPGLPVETIKDL
MRQFLSGLDFLHANCIVHRDLKPENILVTSNGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
EVSLPRGAFSPRGPRPVQSVVPEMEESGAQLLLEMLTFNPLKRISAFRALQHSYLHKEES
DPE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggctaccactcgatatgaacccgtggctgaaattggtgtcggtgcctatgggacggtg
tacaaagcccgagatccccacagtggccactttgtggctctcaagagtgtgagagttcct
aatggaggagcagctggagggggccttcccgtcagcacagttcgtgaggtggccttgtta
agaaggctggaggcctttgaacatcccaatgttgtacggctgatggatgtctgtgctact
tcccgaactgatcgggacatcaaggtcaccttagtgtttgagcatatagaccaggaccta
cggacatacctggacaaagcacctccgccgggcttgcctgttgagaccattaaggatctg
atgcgccagtttctaagcggcctagatttccttcatgcaaactgcattgttcaccgggac
ctgaagccagagaacattctagtgacaagtaatgggacagttaagctggccgactttggc
ctagccagaatctacagctaccagatggccctcacgcctgtggttgttacgctctggtac
cgggctcctgaagttcttctgcagtctacatatgcaacgcctgtggatatgtggagtgtt
ggctgtatcttcgcagagatgtttcgccggaagcctctcttctgtgggaactctgaggct
gaccagctgggcaaaatctttgatctcattggattgcctccagaagacgactggcctcga
gaggtctctcttcctcgaggagccttttcccccagaggacctcggccagtgcagtcagtg
gtgccggagatggaggaatctggagcgcagttgctgctggaaatgctgacctttaatcca
cttaagcgaatctctgccttccgagccctgcagcactcttacctgcacaaggaggaaagt
gacccggagtga

DBGET integrated database retrieval system