KEGG   Rattus norvegicus (rat): 94202Help
Entry
94202             CDS       T01003                                 

Gene name
Ptprr, PC12-PTP1, Pcptp1, R-PTP-R
Definition
(RefSeq) protein tyrosine phosphatase, receptor type, R (EC:3.1.3.48)
  KO
K04458  
receptor-type tyrosine-protein phosphatase R [EC:3.1.3.48]
Organism
rno  Rattus norvegicus (rat)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    94202 (Ptprr)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     94202 (Ptprr)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    94202 (Ptprr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
7q22
AA seq 656 aa AA seqDB search
MRRAVGFPALCLLLNLHAAGCFSRNNDHFLAIRQKKSWKPMFIYDHSQDIKKSLDIAQEA
YKHNYPAPSEVQISKRHQIVDSAFPRPAYDPSLNLLAASGQDLEIENLPIPAANVIVVTL
QMDIDKLNITLLRIFRQGVAAALGLLPQQVHINRLIEKKSQIELFVSPGNRKPGEPQALQ
AEEVLRSLNVDVLRQSLPQFGIIDVSPEKNVLQGQHEADKIWSKEGFYAVVIFLSIFIII
VTCLMIIYRLKERLQLSLRQDKEKNQEIHLSPIALQQAQSEAKAAHSMVQPDQAPKVLNV
VVDPQGQCTPEIRNTASTSVCPSPFRMKPIGLQERRGSNVSLTLDMSSLGNVEPFVAVST
PREKVAMEYLQSASRVLTRPQLRDVVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNRY
KTILPNPLSRVCLRPKNITDPLSTYINANYIRGYSGKEKAFIATQGPMINTVNDFWQMVW
QEDSPVIVMITKLKEKNEKCVLYWPEKRGIYGKVEVLVIGVNECDNYTIRNLVLKRGSHT
QHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLASEGRGPVVVHCSAGIGRTGCFIAT
SIGCQQLKEEGVVDALSIVCQLRVDRGGMVQTSEQYEFVHHALCLFESRLSPETVQ
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgaggagagcggtcggtttccctgcactgtgcctgcttcttaatcttcacgctgcaggg
tgtttttccaggaacaatgaccactttttggctattcgtcaaaagaagagttggaaaccc
atgttcatttatgaccattcccaagacattaagaagagcctggatatcgctcaagaggca
tataaacacaactaccccgccccctcagaagttcaaataagcaaacgtcaccagatcgtt
gattcagcatttcctagacctgcatatgacccatctcttaatctgttggctgcatctggt
caagacctcgaaatagaaaatctcccaattccagcagcaaatgtgattgtggtgacactg
caaatggatatagacaagctgaacataaccttgcttcggatcttccgccaaggagtagct
gcagccctgggactcttacctcagcaagtacacatcaaccgcctcattgaaaagaagagc
cagattgagttgtttgtgtctcccggaaaccggaaaccaggagagccgcaggccctgcag
gctgaggaagtactgcgttcccttaatgtggatgttttgcgtcagagtttaccacagttt
ggaattatagacgtctcccctgagaaaaatgttttacaagggcagcatgaagcggacaag
atctggagcaaagaaggcttttacgccgtcgtcatcttcctcagcatctttatcattata
gtaacctgtttgatgatcatttataggttaaaagaaaggcttcagctttccttacgacaa
gataaagagaaaaaccaggagatccacctatcgcccattgcactccagcaagcacaatcg
gaggccaaggcagcccacagcatggtccagcccgaccaggcgccaaaggtgctgaatgtt
gttgtggaccctcaaggccaatgcactcctgagattcgaaacaccgcctccacttctgtc
tgcccttctcccttcaggatgaagcccataggactccaggagcgacgaggttccaatgta
tctcttacactggacatgagtagcctgggcaacgtggaaccctttgtggccgtctccacc
ccccgggagaaggtagccatggagtacctgcagtcagccagccgagttctcacaaggcca
cagctgagggacgtcgtggcaagttcccacctgcttcaaagtgaattcatggaaatacca
atgaactttgtggatcccaaagaaattgatattccacgtcatggaactaaaaatcgttat
aagaccattttgccaaatcccctcagcagggtgtgcttaagaccaaaaaatataactgac
ccattgagtacttacatcaatgctaattacattcggggctacagtggcaaggagaaagcc
ttcattgccacacagggccccatgatcaacactgtgaatgacttctggcagatggtttgg
caagaagacagtcctgtgattgttatgatcacgaaactcaaagagaaaaatgagaaatgt
gtgctctactggccagaaaagagagggatttacggcaaggttgaggttctggtcatcggt
gtcaatgaatgtgataactacaccatccgcaacctcgtcttgaagcgaggaagtcacacc
caacatgtgaagcattactggtacacttcatggcccgatcacaagactccagacagtgcc
cagccccttctgcagctcatgctggacgtagaggaagacagactggcctctgaaggccga
gggcctgtggttgtccactgcagtgcagggattgggagaaccggatgtttcatcgctaca
tccattggctgtcaacagttgaaagaagaaggagtcgtagatgcactaagtatcgtctgc
cagcttcgtgtagacaggggtggaatggtccaaaccagtgagcagtatgaatttgtgcac
cacgctctgtgcctgttcgagagcagactttcgccagaaacggtccagtga

DBGET integrated database retrieval system