KEGG   Rhodococcus opacus PD630: Pd630_LPD00996Help
Entry
Pd630_LPD00996    CDS       T03071                                 

Definition
putative aminotransferase
Orthology
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
roa  Rhodococcus opacus PD630
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:roa00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Pd630_LPD00996
   00650 Butanoate metabolism
    Pd630_LPD00996
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Pd630_LPD00996
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Pd630_LPD00996
Enzymes [BR:roa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Pd630_LPD00996
Amino acid related enzymes [BR:roa01007]
 Aminotransferase (transaminase)
  Class III
   Pd630_LPD00996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
1005158..1006399
Genome map
AA seq 413 aa AA seqDB search
MTRLSPLLAQATPVTVDHGEGCYLYGTDGRRYLDFTAGIGVTSTGHCHPHVVEAARRQVG
SLIHGQYTTVMHQPMLELVDRLGSVLPPGLDSLFFANSGSEAVEASLRLSRQATGRPNVI
VFHGGFHGRTVATATMTTSGTRFSAGFSPLMGGVHVAPFPNAYRYGWSEEEATAFALKEL
DYIFATLTAPNETAAFVVEPVLGEGGYVPGNTAFFQGLRERADRYGILLVIDEIQTGFGR
TGKFFGHQHFDVRPDIITIAKGLASGFPLSGIAASEELMAKGWPGSQGGTYGGNAVSCAA
AVATLEVIEKEDLVANAAARGVQLLDGARTRAIDGIGDVRGLGLLVGSEFTAADGSADRA
KAAAAQQLAAKKGLLLLTCGAHMNVVRMIPPLIVTSEQIEDALKIWSEVLDEV
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtgactcggctatctccactgctcgcacaggccacacccgtgacggtcgatcacggtgaa
gggtgctacctctacggcaccgacggcaggcgctatctcgacttcaccgcgggcatcggc
gtcaccagtaccgggcactgccacccgcacgtcgtggaggccgcgcgcaggcaggtcggc
tccctgatccacggccagtacacgaccgtcatgcaccagccgatgctcgaactggtcgat
cggctggggtcggtgctgcccccggggctcgactcgctgttcttcgcgaactcggggagt
gaggccgtcgaggcgtcgctgcgactgtcgcggcaggcgaccggccgccccaacgtgatc
gtcttccacggcggcttccacggacgcacggtcgcgacggcgacgatgaccacgtccggc
acccggttctcggccggcttcagcccgctgatgggcggcgtgcatgtggcaccgttcccc
aacgcctaccgctacggctggtccgaggaggaggcgaccgcgttcgcgctgaaggaactc
gactacatcttcgcgacgctcaccgcgccgaacgagacggcggcgttcgtcgtcgagccc
gttctcggtgagggcgggtacgtgcccggtaacaccgcgttcttccagggtctccgcgag
cgcgccgaccggtacggcatcctgctcgtcatcgacgagatccagaccggtttcggccgc
accggcaagtttttcgggcaccagcacttcgacgtccggcccgacatcatcaccatcgcc
aaggggctggccagcggcttcccgctgtcgggcatcgcggcgtccgaggagctcatggcc
aagggctggccggggtcgcagggtggaacatacggcggcaatgccgtgtcctgcgcggcc
gcggtcgcgacactcgaggtgatcgagaaggaagatctcgtggcgaacgccgccgcgcgg
ggcgtccagttgctcgacggtgcgcgcacgcgtgccatcgacgggatcggcgacgtccgt
ggcctcggactgctcgtgggcagcgagttcacggccgccgacggcagcgcggaccgcgcg
aaagcggctgcggcgcagcaactggccgcgaagaaggggctgctgctcttgacctgcggc
gcccacatgaacgtggtacggatgattccaccgctcattgtgacgtcggaacagatcgag
gacgccctgaagatctggtccgaagtactcgacgaagtgtga

DBGET integrated database retrieval system