KEGG   Rhodococcus opacus PD630: Pd630_LPD02151Help
Entry
Pd630_LPD02151    CDS       T03071                                 

Definition
Alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
roa  Rhodococcus opacus PD630
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:roa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Pd630_LPD02151
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Pd630_LPD02151
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Pd630_LPD02151
Enzymes [BR:roa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Pd630_LPD02151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
Position
2286353..2287891
Genome map
AA seq 512 aa AA seqDB search
MYLSRRALLRSTALGLLAVPAAACSDSGSAGPALVRERPTLTHGVAAGDVRADGALVWAR
SDRPATMIVETSATESFTDPVRFEGGLLTPDTDGTGRLRLTGLPAGQQVHYRVTLEGDDG
STSEAVTGVFRTAPSAAGDIRLQWSGDTAGQGYGINPDIGGMRIFDTMAARDPHLFLHSG
DVVYADGPLKESVTLPDGRVWRNTVSEAKSAVAQTLDQYRGQYAYNLTDDNYRRFNSSVA
QIVQWDDHETVNNWYPGEILDLDAYTEKNVDVLAQRAFQAYHEWLPVEPGDAVDGRVYRK
IGYGPLLDVFVLDMRTYKDANGVNTGAAGQILGAAQKDWLIRELGASTATWKIIANDLPL
GVVVPDGDTAFEGVANGEPGQPSGRESEIAQVLSAIKAGRITGTVWLTADVHYTAAHRYS
PDRAAYKDFDEFWEFVSGPLNSGGFGPNDLDATFGPEAVFVHAPPAPNSSPLDGYQHFGE
VFIDGQTSELRVDLLDATGTVLFSQLLPPPAR
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
gtgtatctgtcccgccgtgccctgctccgctccaccgcactcgggttgctggccgtgccc
gccgccgcgtgctccgactccggcagtgcgggtccggcgctggtccgtgaacgccccacc
ctgacgcacggtgtcgcggccggggacgtgcgagccgacggtgcgctcgtctgggcgagg
tccgaccgtcccgccacgatgatcgtggagacctcggccaccgagtccttcaccgacccg
gtgcgattcgagggtggactgctcaccccggacacggacggcaccggacggctgcggctg
accggactacccgcagggcagcaggtgcactaccgggtgactctcgagggcgacgacggt
tccacctcggaggcggtgacgggtgtcttccgcaccgctccgagcgccgcaggcgacatc
cggttgcaatggtccggggacacggctggtcagggatacggaatcaatccggacatcggc
ggaatgcgaatcttcgacacgatggccgcgcgcgacccgcacctgttcctgcactcgggc
gacgtcgtgtacgccgacggtccgctgaaggagtccgtcacgctgccggacggacgcgtg
tggcggaacacggtcagtgaggcgaagagcgcggtcgcgcagacgttggaccagtaccgc
ggccagtacgcgtacaacctcaccgacgacaactaccgcaggttcaattcttctgtggcg
cagatcgttcagtgggacgatcacgagaccgtcaacaactggtaccccggcgagatcctc
gatctcgacgcatacacggagaagaacgtggacgtgctggcgcagagggcattccaggcg
taccacgagtggctgccggtggagccgggcgacgcggtcgacggtcgggtgtaccgcaag
atcgggtacggcccactgctcgacgtgttcgtcctcgacatgcgcacctacaaggacgcg
aacggcgtcaacaccggtgcggccgggcagattctcggtgcggcacagaaggactggctg
atccgggaactcggtgcgtccacggcgacgtggaagatcatcgccaacgacctcccgctc
ggggtggtggtcccggacggcgacaccgcgttcgagggcgtcgcgaacggggagcccggt
cagccgtcgggccgggaatccgagatcgcccaggtgctgtcggcgatcaaggcggggcgg
atcaccgggacggtgtggctcaccgcggacgtgcactacaccgccgcgcaccggtactcg
cccgaccgcgccgcgtacaaggatttcgacgagttctgggagttcgtctccggtccgctc
aactcgggcggtttcggtcccaacgacctcgacgccacgttcggccccgaggccgtgttc
gtgcacgcgccgcccgcacccaactcgtcgccgctcgacggataccagcacttcggtgag
gtgttcatcgacgggcagacgtcggagttgcgggtggacctcctcgacgcgaccgggacg
gtgctcttcagtcagctgctgccgccaccggcgcgctga

DBGET integrated database retrieval system