KEGG   Rhodococcus opacus PD630: Pd630_LPD02196Help
Entry
Pd630_LPD02196    CDS       T03071                                 

Definition
4-aminobutyrate aminotransferase
Orthology
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
roa  Rhodococcus opacus PD630
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:roa00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Pd630_LPD02196
   00650 Butanoate metabolism
    Pd630_LPD02196
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Pd630_LPD02196
   00280 Valine, leucine and isoleucine degradation
    Pd630_LPD02196
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Pd630_LPD02196
Enzymes [BR:roa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Pd630_LPD02196
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     Pd630_LPD02196
Amino acid related enzymes [BR:roa01007]
 Aminotransferase (transaminase)
  Class III
   Pd630_LPD02196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(2336667..2338007)
Genome map
AA seq 446 aa AA seqDB search
MNDIQYRLPQKRALVTELPGPKSAALTARRRATVAAGVGSSVPVYAADADGGVVVDVDGN
SLIDLGSGIAVTSVGASDPAVAEAVREQVGHFTHTCFMVTPYEGYVRVAEELAALTPGDH
EKRTVLFNSGAEAVENAIKVARLATGRDAVVAFDHAYHGRTNLTMALTAKSMPYKAHFGP
FAPEVYRLPMSYPYRDQDGLTGEQAAQRAISQMEKQIGADSLAAIIIEPIQGEGGFIVPA
EGFLPTLVNWARANGVVFIADEVQTGFSRTGAWFACEHEEIVPDIITMAKGMAGGMPLSA
ITGRAELLDKVHPGGLGGTYGGNPVACAAALAAIDSMRKFDLPARAQHIGDLALPRLKAL
AADVGVIGDVRGRGAMLAMEFVKPGTDEPDAELTKAIAAHALEQGVILLTCGTYGNVIRL
LPPLVISDDLLDDALTVIEQIVRSLV
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacatccagtaccggctgccgcagaagcgcgccctggtcaccgagctccccggc
ccgaagtcggcggccctcaccgcacgccgccgcgccaccgtggccgcgggcgtcggctcc
agcgtccccgtgtacgcggcggatgccgacggtggtgtggtcgtcgacgtcgacggcaac
tccctgatcgacctcggctcgggcatcgcggtcaccagcgtgggcgcgtccgatccggcc
gtcgccgaggcggttcgggagcaggtcgggcacttcacccacacctgtttcatggtcacc
ccgtacgagggctacgtccgcgtggcggaggaactcgccgccctcacccccggcgaccac
gagaagcgcaccgtcctgttcaactcgggcgcggaggcggtggagaacgcgatcaaggtt
gctcgcctcgccaccggccgcgacgccgtcgtcgcgttcgaccacgcctaccacggtcgg
acgaacctgacgatggccctcaccgccaagtcgatgccctacaaggcccacttcggtccg
ttcgcacccgaggtgtaccggctccccatgtcctacccctaccgggaccaggacggactg
accggcgagcaggccgcccagcgcgccatcagccagatggagaagcagatcggcgccgat
tcactcgcggcgatcatcatcgagccgatccagggcgagggcggattcatcgttcccgcc
gagggattcctccccaccctggtgaactgggcccgcgccaacggcgtcgtgttcatcgcc
gacgaagtgcagaccgggttctcccgcaccggcgcctggttcgcgtgcgagcacgaggag
atcgtcccggacatcatcacgatggccaagggcatggcgggcggcatgccgctgtccgcg
atcacgggccgcgccgaactcctcgacaaagtgcaccccggcggtctgggtggcacgtac
ggcggcaaccccgtcgcgtgtgccgccgcactcgccgcgatcgacagcatgcggaagttc
gacctgcccgctcgcgcacagcacatcggcgacctggccctgccgcggctgaaggccctg
gccgccgacgtcggcgtcatcggtgacgtgcgcgggcgtggcgcgatgctcgcgatggag
ttcgtcaagcccggcaccgacgagccggacgccgaactgacgaaggcgattgccgcacat
gcgctcgaacaaggtgtcattctgctgacgtgcggtacctacggaaacgtcatccgactg
cttccgccgctggtgatcagcgacgacctgctcgacgacgccctgaccgtcatcgagcag
atcgtgcgctcgctcgtctga

DBGET integrated database retrieval system