KEGG   Rhodococcus opacus PD630: Pd630_LPD03928Help
Entry
Pd630_LPD03928    CDS       T03071                                 

Definition
Phosphoenolpyruvate carboxylase
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
roa  Rhodococcus opacus PD630
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:roa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pd630_LPD03928
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Pd630_LPD03928
  Energy metabolism
   00680 Methane metabolism
    Pd630_LPD03928
Enzymes [BR:roa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Pd630_LPD03928
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
4120458..4123214
Genome map
AA seq 918 aa AA seqDB search
MIETPREATEPLREDIRLLGGILGQIVREQAGDSVFDLVEKARVESFRVRRSEIDRADLA
DMFTQVSTSDTIPVIRAFSHFALLANLAEDIHRERRRAVHVAAGELAPDSTLTATFAKLD
AAHLDSAVVVDALRGALVSPVITAHPTETRRRTVFETQSRITELMRYRERTALTETETAD
VDVRLRRQILTLWQTALIRLSRLRIQDEIEVGLRYYDAALFEVVPKINAELRTALRSRWP
DADLSGEPILRPGSWIGGDRDGNPYVTDEVVRQATTRAAATALEHHLGELETLERELSMS
ARLVTVTPGLDLLAAASQDDSPFRADEPYRRAVRGIRGRLTATAHRILGEAPDHGLDLGL
APYDTPRQMLDELDIVDDSLRRGGDGTIADDGLANLRDSVAVFGFHLSGLDMRQNSDVHE
TVVAELLAWAGVHADYPSLSEAERVELLSAELSTRRPLTTANAKFSELTAKELAILQAGA
DAVRTLGAGAVPNYIISMCTSVSDMLEAAVLLKEVGLLDPGSGEAPSCPVGIVPLFETIE
DLQQGAATLEATLEVPIYRALVTSRGDSQEVMLGYSDSNKDGGYLAANWALYRAELDLVD
AARKTGIRLRLFHGRGGTVGRGGGPSYEAILAQPPGAVAGSLRITEQGEVIAAKYAEPRL
AQRNLETLLAATLEATLLDVEGLGDDAEPAYRILDELAALARRAYGELVHETPGFVEYFE
MSTPVAEIGALNIGSRPASRKQTTSISDLRAIPWVLSWSQSRVMLPGWYGTGAAFEEWTQ
GDPERVATLSRLYEKWPFFRTVLSNLAMVMSKSDMGLAARYAELVPDEELRRRVFGKIAE
EHERTIRMYKAITGNDTLFADNPGLERSVHNRFPYLEPLNHLQVELLRRYRAGDDSDQTR
RGIQLTMNGLATALRNSG
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaaccccacgtgaggccactgaaccactccgcgaagacattcggctcctgggc
ggcatcctcggtcagatagtgcgggaacaggccggggacagcgtcttcgacctcgtcgag
aaggccagggtcgaatcgttccgggttcgtcgttccgagatcgaccgcgcagatctggcg
gacatgttcacccaggtctccacgagcgacacgattcccgtcatccgggccttcagccac
ttcgccctgcttgccaatcttgccgaggacatccaccgcgaacgccggcgtgccgtccac
gtcgccgccggtgaactcgcccccgacagcaccctgaccgccacgttcgccaaactcgac
gccgcgcacctcgacagcgccgtcgtcgtggacgcgttgcgcggggcgctcgtgtcgccg
gtcatcaccgctcatcccaccgagacccgccgccggacggtgttcgaaacccagtcccgg
atcacggaactgatgcgctaccgcgagcgcaccgccctgaccgagaccgagacggccgac
gtcgacgtccggctgcggcggcagatcctcaccctctggcagaccgcgctgatccggttg
tcgcggttgcggatccaggacgagatcgaggtcgggctgcggtactacgacgcggcactg
ttcgaggtcgtcccgaagatcaacgccgaactgcgcactgccctgcggtcgcggtggccg
gacgcggatctgagcggggaaccgattctgcgtcccgggtcgtggatcggcggagaccgc
gacggcaacccctacgtcaccgacgaggtggtccggcaggccacgacccgtgccgcggcc
accgccctcgagcatcacctcggggaactcgagacgctcgagcgcgaactgtcgatgtcg
gctcgcctcgtcaccgtcacccccgggctcgacctcctggccgcggcgtcgcaggacgat
tccccgttccgcgccgacgagccctaccggcgtgcggtgcggggcatccggggtcgtctc
acggccaccgcgcaccgcattctcggtgaggcacccgatcacgggctcgacctcgggctc
gcaccgtacgacaccccgcggcagatgctcgacgaactcgacatcgtcgacgactccctg
cggcgtgggggtgacggcaccatcgccgacgacgggctggcgaacctgcgggactcggtt
gcggtgttcggtttccacctctccggactcgacatgcggcagaactcggacgtgcacgag
acggtcgtcgccgagctgctggcgtgggcgggcgtgcacgccgactacccgtcgctgtcc
gaggccgagcgggtggagttgctgtcggcggagctgtcgacccggcgcccactgaccact
gcgaacgcgaagttcagcgagctgaccgcgaaggagctggccattctccaggccggcgcc
gacgcggtccggacactcggtgcgggcgccgtgcccaactacatcatcagcatgtgcacc
tccgtcagtgacatgctcgaggccgctgtgctgctgaaggaggtgggtctgctcgaccct
ggatcgggggaggcgccgtcctgcccggtgggcatcgtgccgctgttcgagacgatcgaa
gacctgcagcagggtgcggccaccctcgaagccaccctggaggtgccgatctaccgggcg
ctggtgacgtcgcgcggcgactcccaggaagtgatgctcgggtactccgattccaacaag
gacggcggctacctggcggccaactgggcgctgtaccgcgcggagctggatctggtggac
gccgctcgcaagacgggaatccggttgcggctcttccacggtcgcggcggcaccgtgggt
cgcggcggcggccccagctacgaggcgatcctcgcgcaaccgcccggcgcggtggccggc
tccctgcggatcaccgaacagggcgaggtgatcgccgccaagtacgcggaaccccgcctc
gcgcaacgcaatctcgaaacgctgctcgccgcgaccctcgaagccaccctgctcgacgtc
gagggactcggcgacgacgccgaaccggcgtaccgcatcctcgacgagctcgctgcgctg
gcccgccgcgcctacggcgaattggtgcacgagacacccggattcgtggagtacttcgag
atgtcgactccggtcgcggagatcggggccctcaacatcggcagccggcccgcctcacgg
aagcagaccacgtccatctccgatctccgggccatcccgtgggtgctgtcgtggagtcag
tcccgggtcatgctgcccgggtggtacggcacgggtgcggcgttcgaggaatggacgcag
ggcgaccccgagagggtggccacgctgtcccgcctgtacgagaagtggccgttcttccgg
accgtgctgtcgaacctggccatggtgatgtcgaagtccgacatgggcctcgccgcccgc
tacgcggagctggttcccgacgaggaactccgccgacgggtgttcggcaagatcgccgag
gaacacgagcggacgatccggatgtacaaggcgatcaccgggaacgacaccctgttcgcc
gacaaccccggtctggagaggtcggtgcacaaccggttcccgtacctcgagcccctcaac
cacctgcaggtggaactgctgcgccgctaccgggccggggacgacagtgatcagacgcgc
cgcggcatccagctcacgatgaacgggctggcgaccgcgctgcgcaacagcgggtag

DBGET integrated database retrieval system