KEGG   Blautia obeum: CK5_09690Help
Entry
CK5_09690         CDS       T02605                                 

Definition
(GenBank) Ribulose-5-phosphate 4-epimerase and related epimerases and aldolases
  KO
K03077  
L-ribulose-5-phosphate 4-epimerase [EC:5.1.3.4]
Organism
rob  Blautia obeum
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rob00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CK5_09690
   00053 Ascorbate and aldarate metabolism
    CK5_09690
Enzymes [BR:rob01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.4  L-ribulose-5-phosphate 4-epimerase
     CK5_09690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
959262..959915
Genome map
AA seq 217 aa AA seqDB search
MLYEEERKDIIRICLEMQEKKYFLGTWGNVSIRVGNHIILTPSRIGYNDMTPESLVVIDL
EGNIVEGTNRPTSEKEVHRQIYLRREDAGMIIHAHTKKAMAVSVRKIREVPCLVEEMSQL
IGGGIPITPQYVPAEQHFQLGTAAAENIGNRNGVILRNHGPVAVGRNTEEAVLMVEVIEK
ACEIFLDQGQMFYAPIPQCYIDSERYRYLYKYGNENT
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgctctatgaagaagagagaaaagatatcattcggatctgccttgaaatgcaggagaaa
aaatatttccttggtacatggggaaatgtaagtatccgtgttggaaaccatattattctg
acacccagtcgtatcgggtacaatgatatgacaccggagagcctggtagtcattgatctg
gaaggaaatattgtggagggaaccaaccgccccacttctgagaaagaagtacacagacag
atttatctgagaagagaagatgcaggaatgatcattcatgcacatacaaagaaagcgatg
gcggtttctgtccgtaagatcagagaagtgccgtgtctggtagaagaaatgtcacagctg
attggcggaggaatcccaatcactccacaatacgttccggcagagcagcatttccagctg
ggaacagcagcagcagaaaatattggaaacagaaatggagtaatccttcgaaatcatggc
ccggtggcagtcggtcgaaacacggaagaagcagttctgatggttgaggtgatcgaaaaa
gcatgtgaaatctttctggatcagggacagatgttttatgcaccaattccacagtgctat
atagattcagaacgttatcgatacttatataagtatggaaatgaaaatacctga

DBGET integrated database retrieval system