KEGG   Blautia obeum: CK5_13140Help
Entry
CK5_13140         CDS       T02605                                 

Definition
(GenBank) alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rob  Blautia obeum
Pathway
rob00500  Starch and sucrose metabolism
rob01100  Metabolic pathways
rob01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rob00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CK5_13140
Enzymes [BR:rob01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CK5_13140
Exosome [BR:rob04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CK5_13140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase Alpha-amylase_C Glyco_hydro_70 AMPK1_CBM
Motif
Other DBs
NCBI-ProteinID: CBL22762
UniProt: D4LYQ9
Position
1293429..1295315
Genome map
AA seq 628 aa AA seqDB search
MGEKLQFTELDQYLFGQGTHYDIYKKLGAHPTMRGRKKGVYFAVWAPNARSVSVVGDFNE
WDIQKNPMQKTGPIGVYETFIPEAKIGDLYKFYIIGYHGEEIYKADPYGNEAELRPGTAS
RITDISSHKWKDTTWMKHRPEFNEKKSPMAIYEVHPGSWKKHEAKDEDDPGFYNYRELAH
ELAAYVKKMGYTHVELMGIAEHPFDGSWGYQVTGYYAPTSRYGTAEDFKYMIDHLHRNKI
GVILDWVPAHFPKDAHGLANFDGTAVYEHEDPRQGEHPDWGTKIYNYGRPEVKNFLIANA
LFWIEECHVDGLRVDAVASMLYLDYGKKDGEWVANKYGDNKNLEAIEFFKHLNTVVLGRN
HGTVMIAEESTAWPKVTGKAEDGGLGFSLKWNMGWMNDFLEYMKLDPYFRKDNHNKMTFS
MTYAYSENYVLVISHDEVVHLKCSMLNKMPGYPDDKFRNLKAAYAFMLFHPGKKLLFMGQ
EFGQLREWSEERELDWYLLKEEKHQDLQNFVKTLLHMYTKYPALYAADNDPEGFEWINAD
DAYRSIFSLIRKSPTKRNNLLFVVNYTPVDRPDYRVGVPKKKQYKLIMDENGLLDKPKIF
KAEEQECDHREYSFNYSLPGYGVAVFTY
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgggagagaagttgcagtttacagagctggatcagtatctgttcggacagggaacccat
tatgacatttataaaaagctcggggcgcatcctacgatgcggggacgcaaaaaaggtgtc
tattttgcggtgtgggcaccgaatgccagatctgtttctgtagtgggtgattttaatgaa
tgggatattcagaagaacccgatgcagaagacaggaccgatcggagtctatgagaccttt
atacctgaggcaaaaatcggtgacctttataagttttatattatcggttatcacggtgag
gaaatttacaaagctgatccatatggcaatgaagcggagcttcgtccgggaacagcatcc
agaattacagatatttccagtcataaatggaaagatactacctggatgaaacaccgtccg
gaatttaatgagaaaaagagtccgatggcaatttatgaggttcatcccggctcatggaag
aaacatgaagcaaaggatgaggacgatccgggcttttacaattatcgcgaactggcacat
gagctggctgcttatgtgaagaagatgggctatacccatgtcgaactgatgggaatcgca
gagcatccgtttgacggctcctggggctatcaggtaaccggttattatgcaccgacctcc
cgctacggaacagcagaagatttcaaatatatgattgaccatcttcatcgtaataagatc
ggtgttattcttgactgggttccggcacatttcccgaaggatgcacatggacttgcaaac
tttgacggaacggctgtttatgaacatgaagacccgagacagggagagcacccggactgg
ggaacgaagatttacaactacggtcggccggaggtcaaaaacttcctgatcgccaatgcg
cttttctggatagaggagtgccacgtagacggtctgcgtgtcgatgcggttgcatccatg
ctgtatctggattacggcaagaaggacggcgaatgggttgccaataaatatggcgataat
aaaaatctcgaagcgatcgaattttttaaacatctgaatacagttgtgcttggcaggaat
catggtactgtcatgattgcagaagaatcgactgcatggccaaaggttacaggaaaggct
gaagatggcggccttggattttctctgaaatggaatatgggctggatgaatgatttcctg
gaatatatgaaactggatccatacttccgtaaagacaatcacaacaagatgaccttctcc
atgacgtatgcatacagtgaaaattatgtacttgttatttctcatgatgaagttgtacat
ctgaaatgttcaatgcttaacaaaatgcctggatatccggacgataagttccgtaatctg
aaagctgcatatgcgtttatgctgttccatccgggcaagaaacttctgtttatgggacag
gagttcggccagctccgtgaatggagtgaggagagagaacttgactggtatctcctcaaa
gaagaaaagcatcaggatcttcagaattttgtgaagacacttcttcatatgtatacgaag
tacccggcattgtatgcagccgacaatgatccggaaggctttgaatggatcaatgcggat
gatgcatacagaagcattttcagcctgataagaaaatcaccgacgaagcgaaataatctt
ctgtttgtagtaaactacacaccggttgacagaccggattatcgtgtaggagttccgaag
aaaaaacagtacaagctgatcatggatgaaaacggactcctcgacaagccaaagatcttc
aaagcagaagaacaggaatgcgatcacagagaatattcgttcaactactctctcccggga
tatggagttgcagtatttacttattaa

DBGET integrated database retrieval system