KEGG   Ruminococcus obeum A2-162: CK5_15310Help
Entry
CK5_15310         CDS       T02605                                 

Definition
Alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
rob  Ruminococcus obeum A2-162
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rob00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:rob00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:rob00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1518604..1520790
Genome map
AA seq 728 aa AA seqDB search
MAISFDENKKIFKLDTAKSTYLIGLSPEGYIGHIYYGERLNHPADNYLLRMAEHPFTPSV
NKREKAMFLDFFPEEFPSGGVGGYRESCINIRDSHGCMGSEFFYHSHEIYKGKHKLSGLP
ASFGTEDEVETLDIHCRDEVLGLELILSYSVFEKENILTRSTRVVNNGSQKVRIEKIYSA
CLDMDNEDFEMISLHGGWARERHIQQCALHYGKQSAESARGESSHQEHPFIALVTPGTTQ
KQGRVYAMHFVYSGNFLAQAELSQFDSVRMVMGINSEEFSWALAPGEEFQAPEVVMTYSG
AGLGQMSRSYHDFYRNHMIRSKYNHKKRPILINNWEATYFDFNTEKLLDISREAKKCGIE
MLVMDDGWFGHRNNDDSSLGDWFVNEKKITGGLKNLVDQVNKIGLKFGIWFEPEMISPDS
DLYEKHPEWAIQIQNREATQSRNQYVLDLSCREVRDYVYECVASVLRSANIEYVKWDMNR
QLSDMGSAYLAEDAQQELFHRYVLGVYELQERLVTDFPDLLLENCSGGGARFDPGMLYYS
PQIWCSDDTDAIERLMIQEGTELIYPLSAMGAHVSDCPNHIVGRVTPFKTRGHVALSGTF
GYELDITKIAEEERNMIPEQTQMYHKYHDLIREGDYFRIASYRENHLYDCWASAAKDRSE
VLVTYVQVLGQANVHSRRIYLDGFDPDKTYRLEGTDEVYTGEMLMKVGFLMRDFRGDFQS
RLYHFVAE
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atggcgatttcatttgatgaaaataaaaagatcttcaagctggacacagcaaaaagtaca
tatctgatcggactttcaccggaaggatatatcggacatatttattatggagaaaggctg
aaccatccggcagataattatcttctgcgtatggcggagcatccttttacaccttccgta
aacaaaagggaaaaagccatgtttcttgatttcttccctgaagaatttccgtcaggcggt
gtaggcggttacagagaaagctgtatcaacatccgtgacagtcacggatgcatgggaagt
gaattcttttatcattctcatgaaatctacaaaggcaaacataaactgagcggacttccg
gcttctttcggaacagaagatgaggtagaaacactcgatatccactgtcgcgatgaggtg
cttggactggagctgattctttcttactctgtttttgaaaaagaaaatatcctgaccaga
agcaccagagtagtcaataatggcagccagaaagtgcgcatcgagaaaatctacagtgcg
tgtctggatatggacaatgaagactttgaaatgatttctcttcatggcggatgggcgaga
gaacgccatattcagcagtgcgcgctccattacggcaaacagagcgctgagtctgccaga
ggtgaatccagtcatcaggagcatccgtttatcgcacttgtgacgccgggaactacgcag
aaacaggggcgtgtatatgcgatgcatttcgtatattccggaaacttccttgcacaggca
gaactgtcacagtttgattctgtgcgtatggtcatgggtatcaacagtgaagaattttca
tgggcgcttgcaccgggcgaagaatttcaggcaccggaagttgtcatgacttattcaggg
gcaggtcttggtcagatgagcaggagttatcatgatttctacagaaatcatatgatcaga
agtaaatacaatcacaaaaaacgcccgatcctcatcaataactgggaagcaacttatttt
gatttcaatacagaaaaacttctggatatttcccgtgaggcaaagaagtgcggaatcgaa
atgcttgtcatggatgatggctggttcggacatcgaaataacgatgacagttctctcggt
gactggtttgttaatgaaaaaaagattacgggcggtctgaagaatctggtcgatcaggtc
aataagatcggtctgaaattcggtatctggttcgagccggaaatgatttctccggattca
gatctttatgagaaacatccggaatgggcaattcagattcagaacagagaggcaacccag
agccgaaatcaatatgtacttgacctgtcatgcagggaagtacgtgactatgtatatgag
tgtgtggcttccgttcttcgaagcgccaatatcgaatatgttaaatgggacatgaaccgt
cagctcagtgatatgggaagtgcttatcttgccgaagatgcgcagcaggagcttttccac
agatatgtactcggtgtttatgaactgcaggagcgtctggtgacagacttcccggatctt
cttttggagaactgctccggcggtggtgcacgctttgacccgggaatgctgtattacagc
ccacagatctggtgctctgatgatactgatgcgatcgagcgcctgatgattcaggaggga
acagagctgatttatccgctgtctgccatgggcgcgcacgtcagtgactgtccgaaccat
atagtaggcagggtgacaccgttcaagacgagaggtcatgtggctctttccggtacattt
ggctatgaactggatatcacaaagattgcagaagaagagagaaatatgattccggaacag
acacagatgtatcacaaatatcacgatctgatccgtgagggagactatttcagaattgcg
tcctacagagaaaatcatctgtatgactgctgggcgtcggcggcaaaagaccgttccgag
gtactggtaacgtatgtacaggtgcttggacaggcaaatgtgcacagccgcagaatctac
cttgatggatttgatccggacaaaacttaccgtctggaaggcacagacgaagtgtacacc
ggtgaaatgctgatgaaagtgggatttttgatgagagatttcagaggagatttccagagc
aggctgtatcatttcgttgcggaatag

DBGET integrated database retrieval system