KEGG   Ruminococcus obeum: CK5_15310Help
Entry
CK5_15310         CDS       T02605                                 

Definition
Alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
rob  Ruminococcus obeum
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:rob00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CK5_15310
  Lipid metabolism
   00561 Glycerolipid metabolism
    CK5_15310
   00600 Sphingolipid metabolism
    CK5_15310
Enzymes [BR:rob01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     CK5_15310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1518604..1520790
Genome map
AA seq 728 aa AA seqDB search
MAISFDENKKIFKLDTAKSTYLIGLSPEGYIGHIYYGERLNHPADNYLLRMAEHPFTPSV
NKREKAMFLDFFPEEFPSGGVGGYRESCINIRDSHGCMGSEFFYHSHEIYKGKHKLSGLP
ASFGTEDEVETLDIHCRDEVLGLELILSYSVFEKENILTRSTRVVNNGSQKVRIEKIYSA
CLDMDNEDFEMISLHGGWARERHIQQCALHYGKQSAESARGESSHQEHPFIALVTPGTTQ
KQGRVYAMHFVYSGNFLAQAELSQFDSVRMVMGINSEEFSWALAPGEEFQAPEVVMTYSG
AGLGQMSRSYHDFYRNHMIRSKYNHKKRPILINNWEATYFDFNTEKLLDISREAKKCGIE
MLVMDDGWFGHRNNDDSSLGDWFVNEKKITGGLKNLVDQVNKIGLKFGIWFEPEMISPDS
DLYEKHPEWAIQIQNREATQSRNQYVLDLSCREVRDYVYECVASVLRSANIEYVKWDMNR
QLSDMGSAYLAEDAQQELFHRYVLGVYELQERLVTDFPDLLLENCSGGGARFDPGMLYYS
PQIWCSDDTDAIERLMIQEGTELIYPLSAMGAHVSDCPNHIVGRVTPFKTRGHVALSGTF
GYELDITKIAEEERNMIPEQTQMYHKYHDLIREGDYFRIASYRENHLYDCWASAAKDRSE
VLVTYVQVLGQANVHSRRIYLDGFDPDKTYRLEGTDEVYTGEMLMKVGFLMRDFRGDFQS
RLYHFVAE
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atggcgatttcatttgatgaaaataaaaagatcttcaagctggacacagcaaaaagtaca
tatctgatcggactttcaccggaaggatatatcggacatatttattatggagaaaggctg
aaccatccggcagataattatcttctgcgtatggcggagcatccttttacaccttccgta
aacaaaagggaaaaagccatgtttcttgatttcttccctgaagaatttccgtcaggcggt
gtaggcggttacagagaaagctgtatcaacatccgtgacagtcacggatgcatgggaagt
gaattcttttatcattctcatgaaatctacaaaggcaaacataaactgagcggacttccg
gcttctttcggaacagaagatgaggtagaaacactcgatatccactgtcgcgatgaggtg
cttggactggagctgattctttcttactctgtttttgaaaaagaaaatatcctgaccaga
agcaccagagtagtcaataatggcagccagaaagtgcgcatcgagaaaatctacagtgcg
tgtctggatatggacaatgaagactttgaaatgatttctcttcatggcggatgggcgaga
gaacgccatattcagcagtgcgcgctccattacggcaaacagagcgctgagtctgccaga
ggtgaatccagtcatcaggagcatccgtttatcgcacttgtgacgccgggaactacgcag
aaacaggggcgtgtatatgcgatgcatttcgtatattccggaaacttccttgcacaggca
gaactgtcacagtttgattctgtgcgtatggtcatgggtatcaacagtgaagaattttca
tgggcgcttgcaccgggcgaagaatttcaggcaccggaagttgtcatgacttattcaggg
gcaggtcttggtcagatgagcaggagttatcatgatttctacagaaatcatatgatcaga
agtaaatacaatcacaaaaaacgcccgatcctcatcaataactgggaagcaacttatttt
gatttcaatacagaaaaacttctggatatttcccgtgaggcaaagaagtgcggaatcgaa
atgcttgtcatggatgatggctggttcggacatcgaaataacgatgacagttctctcggt
gactggtttgttaatgaaaaaaagattacgggcggtctgaagaatctggtcgatcaggtc
aataagatcggtctgaaattcggtatctggttcgagccggaaatgatttctccggattca
gatctttatgagaaacatccggaatgggcaattcagattcagaacagagaggcaacccag
agccgaaatcaatatgtacttgacctgtcatgcagggaagtacgtgactatgtatatgag
tgtgtggcttccgttcttcgaagcgccaatatcgaatatgttaaatgggacatgaaccgt
cagctcagtgatatgggaagtgcttatcttgccgaagatgcgcagcaggagcttttccac
agatatgtactcggtgtttatgaactgcaggagcgtctggtgacagacttcccggatctt
cttttggagaactgctccggcggtggtgcacgctttgacccgggaatgctgtattacagc
ccacagatctggtgctctgatgatactgatgcgatcgagcgcctgatgattcaggaggga
acagagctgatttatccgctgtctgccatgggcgcgcacgtcagtgactgtccgaaccat
atagtaggcagggtgacaccgttcaagacgagaggtcatgtggctctttccggtacattt
ggctatgaactggatatcacaaagattgcagaagaagagagaaatatgattccggaacag
acacagatgtatcacaaatatcacgatctgatccgtgagggagactatttcagaattgcg
tcctacagagaaaatcatctgtatgactgctgggcgtcggcggcaaaagaccgttccgag
gtactggtaacgtatgtacaggtgcttggacaggcaaatgtgcacagccgcagaatctac
cttgatggatttgatccggacaaaacttaccgtctggaaggcacagacgaagtgtacacc
ggtgaaatgctgatgaaagtgggatttttgatgagagatttcagaggagatttccagagc
aggctgtatcatttcgttgcggaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system