KEGG   Ruminococcus obeum A2-162: CK5_18230Help
Entry
CK5_18230         CDS       T02605                                 

Definition
Ribulose-5-phosphate 4-epimerase and related epimerases and aldolases (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
rob  Ruminococcus obeum A2-162
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:rob00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1846244..1847113
Genome map
AA seq 289 aa AA seqDB search
MVNEFEIKKQICDIGRRIYNRNMVAANDGNISVKLNDNEFLCTPTGVSKGFMTPEFICKV
DAQGNVIQANPGFKPSSEIKMHMRVYQKRPDVGSVVHAHPIYATSFAIAGIPLTQPIMPE
AVIALGCVPIAEYGTPSTMEIPDNLEKYLPYFDAVLLENHGALTWSTDLNAAYMKMESVE
FYAQLLYQSKLLGGPKEFDKENIKKLYEIRRKFGMPGKHPASLCQNKDGVNCHNCGGACH
NEDYKQFPGYQYDFVGGDCSKEAAPAAGNADAELVANITKQVMAQLGLK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggtaaacgaatttgaaatcaaaaaacagatctgtgacatcggaagacgtatctacaac
cgtaacatggttgcagcaaacgacggaaacatctccgtaaaactgaatgacaacgaattc
ctctgcacaccaacaggtgtatccaaaggatttatgacaccagagttcatctgtaaagta
gatgctcagggtaacgtaatccaggctaacccgggattcaaaccatcttctgagatcaaa
atgcatatgagagtatatcagaagagaccagacgtaggatctgtagtacatgctcatcca
atctatgctacatccttcgctatcgctggtatcccgcttacacagccgatcatgccggaa
gcagttatcgctcttggatgcgttccgatcgctgagtacggtacaccttccacaatggaa
attccggacaaccttgaaaaatatcttccatacttcgatgcagttcttcttgagaaccac
ggagctcttacatggagcacagacctgaatgctgcatacatgaagatggaatcagtagaa
ttctacgcacagcttctgtatcagagcaaactgctcggcggcccgaaggaattcgataaa
gaaaacatcaagaaactgtatgaaatccgtcgtaaattcggtatgccaggaaaacatccg
gcaagtctctgccagaacaaagacggtgttaactgtcataactgcggtggtgcctgccac
aatgaagattacaaacagttcccgggatatcagtatgatttcgttggtggcgactgttca
aaagaagcagctccggcagctggaaacgctgatgcagaactggttgctaacatcacaaaa
caggttatggcacagcttggcctgaaataa

DBGET integrated database retrieval system