KEGG   Ruminococcus obeum: CK5_18230Help
Entry
CK5_18230         CDS       T02605                                 

Definition
Ribulose-5-phosphate 4-epimerase and related epimerases and aldolases (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
rob  Ruminococcus obeum
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rob00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CK5_18230
Enzymes [BR:rob01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     CK5_18230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1846244..1847113
Genome map
AA seq 289 aa AA seqDB search
MVNEFEIKKQICDIGRRIYNRNMVAANDGNISVKLNDNEFLCTPTGVSKGFMTPEFICKV
DAQGNVIQANPGFKPSSEIKMHMRVYQKRPDVGSVVHAHPIYATSFAIAGIPLTQPIMPE
AVIALGCVPIAEYGTPSTMEIPDNLEKYLPYFDAVLLENHGALTWSTDLNAAYMKMESVE
FYAQLLYQSKLLGGPKEFDKENIKKLYEIRRKFGMPGKHPASLCQNKDGVNCHNCGGACH
NEDYKQFPGYQYDFVGGDCSKEAAPAAGNADAELVANITKQVMAQLGLK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggtaaacgaatttgaaatcaaaaaacagatctgtgacatcggaagacgtatctacaac
cgtaacatggttgcagcaaacgacggaaacatctccgtaaaactgaatgacaacgaattc
ctctgcacaccaacaggtgtatccaaaggatttatgacaccagagttcatctgtaaagta
gatgctcagggtaacgtaatccaggctaacccgggattcaaaccatcttctgagatcaaa
atgcatatgagagtatatcagaagagaccagacgtaggatctgtagtacatgctcatcca
atctatgctacatccttcgctatcgctggtatcccgcttacacagccgatcatgccggaa
gcagttatcgctcttggatgcgttccgatcgctgagtacggtacaccttccacaatggaa
attccggacaaccttgaaaaatatcttccatacttcgatgcagttcttcttgagaaccac
ggagctcttacatggagcacagacctgaatgctgcatacatgaagatggaatcagtagaa
ttctacgcacagcttctgtatcagagcaaactgctcggcggcccgaaggaattcgataaa
gaaaacatcaagaaactgtatgaaatccgtcgtaaattcggtatgccaggaaaacatccg
gcaagtctctgccagaacaaagacggtgttaactgtcataactgcggtggtgcctgccac
aatgaagattacaaacagttcccgggatatcagtatgatttcgttggtggcgactgttca
aaagaagcagctccggcagctggaaacgctgatgcagaactggttgctaacatcacaaaa
caggttatggcacagcttggcctgaaataa

DBGET integrated database retrieval system