KEGG   Ruminococcus obeum: CK5_18920Help
Entry
CK5_18920         CDS       T02605                                 

Definition
Sugar kinases, ribokinase family (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
rob  Ruminococcus obeum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:rob00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CK5_18920
Enzymes [BR:rob01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CK5_18920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1928839..1929744
Genome map
AA seq 301 aa AA seqDB search
MDLFVEGANAIPRYGESIRCRHYGYAPGGKGSNQAFAVAKQGADVVFVGCIGDDENGKQL
KASLDEAGVNTDYLVVDPETQTGLALMLLDDRTGRYVSYVAMGGNDRLSPDAVRKAMDEN
EFDMVVMQLEMPLETVYQTYELAREKGIPVFLDAGPAMKIPLERLKGLFILSPNEAETEA
LTGICIDSNENALKAAKWLYDEVSPQYVILKMGERGALLYNGTEAKFIECFKVKAVDSTA
AGDTFGAALAIRLCKGSKIEDAILFAHAAAGICVSRLGAQTSIPTEEEVENFLTERIGGV
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggatctctttgtggaaggtgcaaatgcaattccgcgatacggagaatccattcgatgc
agacattatggttatgctcctggcggcaaaggctctaatcaggcctttgccgttgctaaa
cagggagcggacgttgtatttgtaggatgtatcggagatgatgaaaacggaaagcagtta
aaagcatctctggatgaggccggtgtaaacacagattatctggtggtagatcctgagaca
cagacaggactggcactgatgctgctggacgatcggactggcagatatgtatcctatgta
gctatgggcggtaatgatcggttaagtccggatgctgtcagaaaagcaatggatgaaaat
gaatttgatatggtagtcatgcagcttgaaatgccgcttgaaacagtttaccagacctat
gaattggccagggaaaaaggaataccggtatttctggatgcagggccggctatgaagatt
ccgctggaacgattaaaaggtctttttattttatcaccaaatgaagcagaaacagaagcc
cttaccggaatctgtatagacagcaatgaaaatgcactcaaagctgcaaaatggctgtat
gatgaggtaagtcctcagtatgtcatcctgaagatgggagaaagaggtgctctgctttat
aatggaacagaggcaaaattcatcgagtgctttaaggtaaaagcagtagattccacagca
gcaggagatactttcggtgctgcactggcaatcagactctgcaaaggcagcaagattgaa
gatgcaattctttttgcacatgcagcagcaggcatctgcgtatcaagactgggtgcacag
acctcaataccgacagaggaagaagtagaaaacttcctgacagaaagaatcggaggtgtc
ctgtaa

DBGET integrated database retrieval system