KEGG   Ruminococcus obeum: CK5_23280Help
Entry
CK5_23280         CDS       T02605                                 

Definition
Aspartate/tyrosine/aromatic aminotransferase (EC:2.6.1.-)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
rob  Ruminococcus obeum
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rob00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    CK5_23280
   01230 Biosynthesis of amino acids
    CK5_23280
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CK5_23280
   00290 Valine, leucine and isoleucine biosynthesis
    CK5_23280
Enzymes [BR:rob01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     CK5_23280
    2.6.1.66  valine---pyruvate transaminase
     CK5_23280
Amino acid related enzymes [BR:rob01007]
 Aminotransferase (transaminase)
  Class I
   CK5_23280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2374387..2375604
Genome map
AA seq 405 aa AA seqDB search
MRTFNKSTKLDNVLYDVRGPVVDEAARMEDEGKEILKLNIGNPYPFGFSAPQEVILDMLS
NIRTSQGYSDSKGIFSARKAIMQYAQLRNIPNVSMNDIYTGNGVSELINLCMQALLDNGD
EILIPAPDYPLWTATATLAGGNVVHYVCDEQSDWYPDIDDIRSKITDKTKAIVIINPNNP
TGAVYPKEILEQIVQIAREKELIIFSDEIYDRLVMDGYEHTSIASLAPDVFCVTFSGLSK
SHMIAGFRIGWMILSGAKDKAKGYIEGIKMLSSMRLCSNVPAQSIVQTALGGYQSVTEYI
KPGGRVYEQRECIYNALRDIPGISVVKPHAAFYIFPKIDTEKFNITDDEQFALDFLHEKQ
VLLVPGKGFNWMQPDHFRVVYLPNIRQLERASEKLREFLSTYRQR
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagaacatttaacaaatcaacgaaactcgataatgtactgtatgatgtgagaggcccg
gtggttgacgaggcggcgagaatggaagatgaaggaaaggaaatcctgaaactgaatatc
ggaaatccatatccgttcggtttttccgctcctcaggaagtcattctggacatgctcagc
aatatccgtacatctcagggatattctgattcgaaagggattttttcagcacgcaaggca
attatgcagtatgcgcagcttcgaaatatcccgaatgtttcaatgaatgatatttataca
ggaaatggtgtcagcgagctgatcaatctctgcatgcaggcacttcttgataatggtgat
gagatcctgatcccggcaccggattatccgctttggacagcgacagcaacactggccggt
ggtaatgtggtacattacgtttgtgatgaacagtccgactggtatccggatattgacgat
atccgaagcaagattacagacaaaacaaaggcaatcgttatcatcaatccaaacaaccca
accggagcagtttatccgaaggaaattctggagcagatcgtacagattgcaagagagaag
gagctgatcatcttttcagatgaaatctatgaccgtctggttatggatggatatgaacat
acttccatcgcatctctggccccggatgttttctgcgtaacattttccggactttcgaag
tcacatatgatcgcaggtttccgtattggctggatgattttaagcggtgcgaaggacaag
gcaaaaggttatatagaaggaatcaagatgctttcttccatgcgtctgtgttccaatgtt
ccggctcagtccattgtgcagactgcactggggggatatcagagcgttaccgaatatatt
aaaccgggcggaagagtttatgaacagagagaatgcatctataatgcactgagagatatt
ccgggaatttctgttgtcaaaccacatgcggcattttatattttcccgaagatcgataca
gagaaattcaacatcacggatgatgaacagtttgcactggattttcttcatgagaagcag
gtactgcttgttccgggtaagggatttaactggatgcagccggatcacttcagagtggtt
tatctgccgaacatcagacagcttgagcgcgcatcagaaaagctgcgtgagttcctgagt
acttaccgtcagcggtag

DBGET integrated database retrieval system