KEGG   Blautia obeum: CK5_24630Help
Entry
CK5_24630         CDS       T02605                                 

Definition
(GenBank) uroporphyrinogen-III synthase/uroporphyrinogen-III C-methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
rob  Blautia obeum
Pathway
rob00860  Porphyrin and chlorophyll metabolism
rob01100  Metabolic pathways
rob01110  Biosynthesis of secondary metabolites
rob01120  Microbial metabolism in diverse environments
Module
rob_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:rob00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CK5_24630
Enzymes [BR:rob01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     CK5_24630
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CK5_24630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase MGS
Motif
Other DBs
NCBI-ProteinID: CBL23773
UniProt: D4LSL5
Position
2504685..2506187
Genome map
AA seq 500 aa AA seqDB search
MKKGKVWLVGAGPGDIGLFTLKGMEVLKNADVVVYDSLVGQGVLAKIPTEARLINVGKRA
DKHTMPQEGINQVLLEEALKGNRVVRLKGGDPFLFGRGGEELELLTENEIPYEIVPGVTS
SIAVPAYNGIPVTHRDFCSSVHIITGHRRAGEKYDIDFKALTNTKGTLVFLMGIAALADI
CQGLLDAGMDPDMPAAVLQKGTTADQKRVVATVSTLKEEVERQGIETPAIIVVGKVCKLA
ANFGWYENLSLAGWKVLVTRPKGRSSRTADELRKRGAEVLELPSIRTVALDEQTELWQAF
DRMDTYQWIAFTSPTGAEIFFEELKNAHKDIRSLAGVHIAAIGQGTAKVLEERGILVDLI
PEIYDGDSLGEALAAKLTGGEKVLLPRAGKGNENLVKILKTHGARVDDIATYDTVYEKSR
LINIGEEIRTGSIDCVVFTSASTVKGFVESTGLADYSGVVAACIGKQTKAAADAYGMQTF
VAEKATIEALIELVVKIKNK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagggaaaagtatggcttgtcggagccggaccgggagatatcggcctttttact
ttgaagggaatggaagtcctgaagaatgcagatgttgttgtttatgacagccttgtaggt
cagggtgttctggcaaaaattccgacagaggcaagattaataaatgtaggaaaacgtgca
gataaacatacgatgccacaggaaggcatcaatcaggtgctcctggaagaagccctgaag
ggaaatcgtgttgtacgtcttaaaggtggtgatccgttccttttcggacgtggcggagaa
gaactggaacttctgacagaaaatgaaattccgtatgagatcgttccgggagttacatct
tccattgcagtaccggcatacaatggaattccggtcacacatcgtgatttctgttcatcg
gtgcatatcattaccggacaccggagagcaggtgaaaaatatgacattgattttaaagcg
ctgacaaatacgaagggaacgctggtttttcttatgggaattgcagcacttgcagatatc
tgtcaggggcttcttgatgcaggaatggatccggatatgcctgcggcagttctccagaag
ggaacgacagctgatcagaagcgcgttgtagcaaccgtttccactctgaaagaagaggta
gaaaggcagggaatcgagacaccggcaattattgtagtcggtaaagtatgtaagcttgct
gcaaacttcggatggtatgaaaatctttctcttgcaggatggaaagtgcttgtaaccaga
ccgaagggacgcagttcccgtactgcagatgaacttcgaaaaagaggggcagaagtgctg
gaactgccgtctatcagaactgttgcgctggatgagcagacggagctttggcaggcattt
gacagaatggacacttatcagtggattgcttttacaagtccgacaggcgcagagattttc
tttgaagaactgaaaaatgcgcacaaagatatccgtagtctggcgggagtacatattgcg
gcaatcggtcagggaactgcgaaagtactggaagaaagaggtattctcgtagatctgatt
ccggaaatttatgatggcgattcactgggagaagcccttgcggcaaaacttacaggtggg
gagaaagtccttctcccaagagcaggaaaaggaaatgaaaatcttgtaaagattcttaaa
actcatggtgccagagtggatgatattgcaacatatgataccgtctatgaaaaaagccga
ctgatcaatatcggagaagaaatccgtacaggttctatcgactgtgtggtatttacaagt
gcatcaactgtaaaaggatttgtcgaaagtacaggacttgcagattattcgggtgttgtg
gcagcatgtatcggcaaacagacaaaagctgcggctgatgcatacggcatgcagacattt
gtggcagaaaaagcaacgattgaggctttgatcgagctcgttgtgaagataaaaaacaaa
taa

DBGET integrated database retrieval system