KEGG   Ruminococcus obeum: CK5_24630Help
Entry
CK5_24630         CDS       T02605                                 

Definition
uroporphyrinogen-III synthase/uroporphyrinogen-III C-methyltransferase (EC:2.1.1.107 4.2.1.75)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
rob  Ruminococcus obeum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rob00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CK5_24630
Enzymes [BR:rob01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     CK5_24630
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CK5_24630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2504685..2506187
Genome map
AA seq 500 aa AA seqDB search
MKKGKVWLVGAGPGDIGLFTLKGMEVLKNADVVVYDSLVGQGVLAKIPTEARLINVGKRA
DKHTMPQEGINQVLLEEALKGNRVVRLKGGDPFLFGRGGEELELLTENEIPYEIVPGVTS
SIAVPAYNGIPVTHRDFCSSVHIITGHRRAGEKYDIDFKALTNTKGTLVFLMGIAALADI
CQGLLDAGMDPDMPAAVLQKGTTADQKRVVATVSTLKEEVERQGIETPAIIVVGKVCKLA
ANFGWYENLSLAGWKVLVTRPKGRSSRTADELRKRGAEVLELPSIRTVALDEQTELWQAF
DRMDTYQWIAFTSPTGAEIFFEELKNAHKDIRSLAGVHIAAIGQGTAKVLEERGILVDLI
PEIYDGDSLGEALAAKLTGGEKVLLPRAGKGNENLVKILKTHGARVDDIATYDTVYEKSR
LINIGEEIRTGSIDCVVFTSASTVKGFVESTGLADYSGVVAACIGKQTKAAADAYGMQTF
VAEKATIEALIELVVKIKNK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagggaaaagtatggcttgtcggagccggaccgggagatatcggcctttttact
ttgaagggaatggaagtcctgaagaatgcagatgttgttgtttatgacagccttgtaggt
cagggtgttctggcaaaaattccgacagaggcaagattaataaatgtaggaaaacgtgca
gataaacatacgatgccacaggaaggcatcaatcaggtgctcctggaagaagccctgaag
ggaaatcgtgttgtacgtcttaaaggtggtgatccgttccttttcggacgtggcggagaa
gaactggaacttctgacagaaaatgaaattccgtatgagatcgttccgggagttacatct
tccattgcagtaccggcatacaatggaattccggtcacacatcgtgatttctgttcatcg
gtgcatatcattaccggacaccggagagcaggtgaaaaatatgacattgattttaaagcg
ctgacaaatacgaagggaacgctggtttttcttatgggaattgcagcacttgcagatatc
tgtcaggggcttcttgatgcaggaatggatccggatatgcctgcggcagttctccagaag
ggaacgacagctgatcagaagcgcgttgtagcaaccgtttccactctgaaagaagaggta
gaaaggcagggaatcgagacaccggcaattattgtagtcggtaaagtatgtaagcttgct
gcaaacttcggatggtatgaaaatctttctcttgcaggatggaaagtgcttgtaaccaga
ccgaagggacgcagttcccgtactgcagatgaacttcgaaaaagaggggcagaagtgctg
gaactgccgtctatcagaactgttgcgctggatgagcagacggagctttggcaggcattt
gacagaatggacacttatcagtggattgcttttacaagtccgacaggcgcagagattttc
tttgaagaactgaaaaatgcgcacaaagatatccgtagtctggcgggagtacatattgcg
gcaatcggtcagggaactgcgaaagtactggaagaaagaggtattctcgtagatctgatt
ccggaaatttatgatggcgattcactgggagaagcccttgcggcaaaacttacaggtggg
gagaaagtccttctcccaagagcaggaaaaggaaatgaaaatcttgtaaagattcttaaa
actcatggtgccagagtggatgatattgcaacatatgataccgtctatgaaaaaagccga
ctgatcaatatcggagaagaaatccgtacaggttctatcgactgtgtggtatttacaagt
gcatcaactgtaaaaggatttgtcgaaagtacaggacttgcagattattcgggtgttgtg
gcagcatgtatcggcaaacagacaaaagctgcggctgatgcatacggcatgcagacattt
gtggcagaaaaagcaacgattgaggctttgatcgagctcgttgtgaagataaaaaacaaa
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system