KEGG   Ruminococcus obeum: CK5_24950Help
Entry
CK5_24950         CDS       T02605                                 

Definition
Sugar kinases, ribokinase family (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
rob  Ruminococcus obeum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:rob00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CK5_24950
Enzymes [BR:rob01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CK5_24950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2538752..2539630
Genome map
AA seq 292 aa AA seqDB search
MKVLNFGSLNLDYVYQVESILIPGETQASKSRQTFCGGKGLNQSIALAKAGIPVYHAGLI
GEGGEQLLEVCRENGVNTEFIKQIPGLCGHTVIQVDRNGQNCILLFGGSNRSMSKEFVDS
VLDSFEEGDIILLQNEINELDYIIDRAYEKKMMIILNPSPFDSALESCDLSKISLFLMNE
IEGFQITGEKEPDKILAKVKKLYPNAKVVLTLGGDGSVYQDETGIYRQGIFKVKAVDTTA
AGDTFTGYFISSIIDGMPVQDGLKLAAKASAIAVSRAGATASIPVRSEVVEK
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtattaaattttggttctcttaatctggactatgtgtaccaggtggaatccatt
ctgattccgggagaaacacaggcatcaaaaagcagacagaccttttgtggcggtaaaggc
ctgaaccagtctatcgcactggcaaaggctgggattcctgtatatcatgccggactgatc
ggagaaggcggcgaacagttgcttgaagtatgcagagaaaacggcgtaaatacagagttt
attaaacagattccgggactatgcggtcatacggtcattcaggtcgatcgaaatggtcag
aactgtatccttctttttggaggatccaacagaagtatgtcaaaagaatttgtagattct
gtactggattcttttgaggaaggtgatatcattctccttcagaatgaaatcaatgaactt
gattatattattgaccgtgcatatgaaaagaaaatgatgattattttgaatccatctccg
tttgacagtgcactggaaagttgtgatctgtccaaaatcagcctgtttctaatgaatgag
attgagggattccagattaccggagaaaaggagccagacaaaatccttgcgaaggtgaaa
aaactttatccaaatgcaaaagtcgttctgacacttgggggcgacggttccgtatatcag
gatgaaacaggaatttaccgtcagggaatttttaaagtaaaggctgttgatacgacagcg
gcaggggatacatttaccggatatttcatttcatctattattgatggaatgcctgttcag
gacgggctcaagcttgctgcaaaggcatctgcgattgcagtttccagagccggcgcgacg
gcatccattccggttcggagtgaagttgtggagaaatag

DBGET integrated database retrieval system