KEGG   Ruminococcus obeum: CK5_34380Help
Entry
CK5_34380         CDS       T02605                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
rob  Ruminococcus obeum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rob00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CK5_34380
Enzymes [BR:rob01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CK5_34380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3515650..3517149
Genome map
AA seq 499 aa AA seqDB search
MAKKRKCGVLLPVSSLPSKYGIGCFDKKAYEFVDALKEAGQSYWQILPLGPTSYGDSPYQ
SFSTFAGNPYFISLEELIKEGVLTKKECESVDFGTDATSVDYAKLYEGRMILLRKAYERS
NVYMDSEFRRFQEEEAWWLKDYALFMAVKKRFGGIPWSEWAEDIRLRWQNALDYYREEMY
FEIEFQEYMQFKFRQQWMKLKAYANEKGIQIIGDIPIYVAMDSADTWANPWLFKLDEKNC
PIQVAGCPPDGFSATGQLWGNPLYKWEVHRNSGYEWWVKRIANCFRLYDVVRIDHFRGFD
EYYAIPYGDKTAENGWWEKGPGIELFRTISEKLGHREIIAEDLGYMTDTVKKLVEESGYP
NMKVIEFAFDERDTGNASDYLPHNYPRNCVVYTGTHDNETLVSWLDNITPQERRQVRKYL
NNFHDSGKELCDDLICLVMQSVADLCIIPMQDYLGLDNSARMNQPSTLGKNWKWRLKEGQ
FSKELRGEMLELAGRYGRL
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaaaagaaaatgcggtgtgctgcttccggtcagcagtctgccgtcaaaatat
ggaatcggctgctttgacaaaaaagcgtatgagtttgtggatgcgctgaaagaagcagga
cagagttactggcagattctgccgcttggtccgacaagctatggcgattctccgtatcag
tcattttccacatttgcaggaaatccgtattttattagtcttgaagaactgataaaagaa
ggtgtcctgacaaaaaaagaatgtgagagcgtggatttcggaacggatgcgacaagcgta
gattatgcaaaattatatgaaggacgtatgattttgctccgtaaagcatatgaacgcagc
aacgtatacatggattcggaatttcgcagatttcaggaagaagaggcatggtggctgaaa
gattatgcactgtttatggcagtgaagaaacgcttcggcggtattccgtggagtgaatgg
gctgaggacatccgtcttcgctggcagaatgcgctcgattattacagagaagaaatgtat
tttgaaatcgaatttcaggagtatatgcagttcaaattccgccagcagtggatgaaactg
aaagcttatgcaaatgaaaaaggaatccagatcattggtgatatcccgatctatgtggca
atggacagtgctgacacatgggcaaatccatggctttttaaactcgatgaaaaaaactgt
ccgatacaggttgcaggctgcccgccggacggattttctgcaacaggacagctctgggga
aatccactgtacaaatgggaagtgcatcgcaattccggatatgaatggtgggtaaagcga
atcgcaaactgtttccgtctgtatgatgtagtgcgaattgatcatttccgcggatttgat
gaatattatgcaatcccgtacggtgataagacagcagagaacggctggtgggaaaaaggc
ccgggaatcgagctgttccgcacgatttcagaaaaactcggacatcgtgagatcattgca
gaagatcttggttatatgaccgacacggttaagaaactggtcgaagaaagcggctacccg
aatatgaaggtcatcgaatttgcattcgacgagcgcgatacgggtaatgcaagcgattat
ctgccgcataattatccgagaaactgcgtggtttatacaggaactcatgacaatgagact
ctggtatcatggcttgataatattacaccacaggagcgcagacaggttcgcaaatatctg
aataatttccatgattccggaaaagaactttgtgacgatctgatctgccttgtgatgcag
agcgtagctgatctttgtatcataccgatgcaggactatctgggacttgataattccgca
cgaatgaatcagccgtccacacttggaaagaactggaaatggcgtttgaaagaaggacaa
ttttctaaagaactgcggggagaaatgctggaacttgcaggacgctacggaagattatag

DBGET integrated database retrieval system